KEGG   Homo sapiens (human): 3425Help
Entry
3425              CDS       T01001                                 

Gene name
IDUA, IDA, MPS1
Definition
iduronidase, alpha-L- (EC:3.2.1.76)
Orthology
K01217  
L-iduronidase [EC:3.2.1.76]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Dermatan sulfate degradation
Heparan sulfate degradation
Disease
H00128  
Mucopolysaccharidosis type I (MPS1)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    3425 (IDUA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    3425 (IDUA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.76  L-iduronidase
     3425 (IDUA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 653 aa AA seqDB search
MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQ
ADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDL
LRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETW
NEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRH
CHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEA
DPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPF
AQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGV
LASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGL
CSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHV
CARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPS
TFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccctgcgcccccgcgccgcgctgctggcgctcctggcctcgctcctggccgcg
cccccggtggccccggccgaggccccgcacctggtgcatgtggacgcggcccgcgcgctg
tggcccctgcggcgcttctggaggagcacaggcttctgccccccgctgccacacagccag
gctgaccagtacgtcctcagctgggaccagcagctcaacctcgcctatgtgggcgccgtc
cctcaccgcggcatcaagcaggtccggacccactggctgctggagcttgtcaccaccagg
gggtccactggacggggcctgagctacaacttcacccacctggacgggtacctggacctt
ctcagggagaaccagctcctcccagggtttgagctgatgggcagcgcctcgggccacttc
actgactttgaggacaagcagcaggtgtttgagtggaaggacttggtctccagcctggcc
aggagatacatcggtaggtacggactggcgcatgtttccaagtggaacttcgagacgtgg
aatgagccagaccaccacgactttgacaacgtctccatgaccatgcaaggcttcctgaac
tactacgatgcctgctcggagggtctgcgcgccgccagccccgccctgcggctgggaggc
cccggcgactccttccacaccccaccgcgatccccgctgagctggggcctcctgcgccac
tgccacgacggtaccaacttcttcactggggaggcgggcgtgcggctggactacatctcc
ctccacaggaagggtgcgcgcagctccatctccatcctggagcaggagaaggtcgtcgcg
cagcagatccggcagctcttccccaagttcgcggacacccccatttacaacgacgaggcg
gacccgctggtgggctggtccctgccacagccgtggagggcggacgtgacctacgcggcc
atggtggtgaaggtcatcgcgcagcatcagaacctgctactggccaacaccacctccgcc
ttcccctacgcgctcctgagcaacgacaatgccttcctgagctaccacccgcaccccttc
gcgcagcgcacgctcaccgcgcgcttccaggtcaacaacacccgcccgccgcacgtgcag
ctgttgcgcaagccggtgctcacggccatggggctgctggcgctgctggatgaggagcag
ctctgggccgaagtgtcgcaggccgggaccgtcctggacagcaaccacacggtgggcgtc
ctggccagcgcccaccgcccccagggcccggccgacgcctggcgcgccgcggtgctgatc
tacgcgagcgacgacacccgcgcccaccccaaccgcagcgtcgcggtgaccctgcggctg
cgcggggtgccccccggcccgggcctggtctacgtcacgcgctacctggacaacgggctc
tgcagccccgacggcgagtggcggcgcctgggccggcccgtcttccccacggcagagcag
ttccggcgcatgcgcgcggctgaggacccggtggccgcggcgccccgccccttacccgcc
ggcggccgcctgaccctgcgccccgcgctgcggctgccgtcgcttttgctggtgcacgtg
tgtgcgcgccccgagaagccgcccgggcaggtcacgcggctccgcgccctgcccctgacc
caagggcagctggttctggtctggtcggatgaacacgtgggctccaagtgcctgtggaca
tacgagatccagttctctcaggacggtaaggcgtacaccccggtcagcaggaagccatcg
accttcaacctctttgtgttcagcccagacacaggtgctgtctctggctcctaccgagtt
cgagccctggactactgggcccgaccaggccccttctcggaccctgtgccgtacctggag
gtccctgtgccaagagggcccccatccccgggcaatccatga

DBGET integrated database retrieval system