KEGG   Homo sapiens (human): 3458Help
Entry
3458              CDS       T01001                                 

Gene name
IFNG, IFG, IFI
Definition
interferon, gamma
Orthology
K04687  
interferon gamma
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Regulation of autophagy
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Type I diabetes mellitus
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H01132  
Aplastic anemia (AA)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    3458 (IFNG)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3458 (IFNG)
   04630 Jak-STAT signaling pathway
    3458 (IFNG)
   04066 HIF-1 signaling pathway
    3458 (IFNG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3458 (IFNG)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    3458 (IFNG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3458 (IFNG)
   04612 Antigen processing and presentation
    3458 (IFNG)
   04660 T cell receptor signaling pathway
    3458 (IFNG)
  Development
   04380 Osteoclast differentiation
    3458 (IFNG)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    3458 (IFNG)
   05323 Rheumatoid arthritis
    3458 (IFNG)
   05321 Inflammatiory bowel disease (IBD)
    3458 (IFNG)
   05330 Allograft rejection
    3458 (IFNG)
   05332 Graft-versus-host disease
    3458 (IFNG)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3458 (IFNG)
  Infectious diseases
   05132 Salmonella infection
    3458 (IFNG)
   05152 Tuberculosis
    3458 (IFNG)
   05162 Measles
    3458 (IFNG)
   05164 Influenza A
    3458 (IFNG)
   05168 Herpes simplex infection
    3458 (IFNG)
   05169 Epstein-Barr virus infection
    3458 (IFNG)
   05146 Amoebiasis
    3458 (IFNG)
   05144 Malaria
    3458 (IFNG)
   05145 Toxoplasmosis
    3458 (IFNG)
   05140 Leishmaniasis
    3458 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    3458 (IFNG)
   05143 African trypanosomiasis
    3458 (IFNG)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3458 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14
AA seq 166 aa AA seqDB search
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system