KEGG   Homo sapiens (human): 3481Help
Entry
3481              CDS       T01001                                 

Gene name
IGF2, C11orf43, IGF-II, PP9974
Definition
insulin-like growth factor 2 (somatomedin A)
Orthology
K13769  
insulin-like growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Disease
H00033  
Adrenal carcinoma
H00711  
Russell-Silver syndrome
H00713  
Beckwith-Wiedemann syndrome
Drug target
Other: 
Class
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 180 aa AA seqDB search
MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcccaatggggaagtcgatgctggtgcttctcaccttcttggccttcgcctcg
tgctgcattgctgcttaccgccccagtgagaccctgtgcggcggggagctggtggacacc
ctccagttcgtctgtggggaccgcggcttctacttcagcaggcccgcaagccgtgtgagc
cgtcgcagccgtggcatcgttgaggagtgctgtttccgcagctgtgacctggccctcctg
gagacgtactgtgctacccccgccaagtccgagagggacgtgtcgacccctccgaccgtg
cttccggacaacttccccagataccccgtgggcaagttcttccaatatgacacctggaag
cagtccacccagcgcctgcgcaggggcctgcctgccctcctgcgtgcccgccggggtcac
gtgctcgccaaggagctcgaggcgttcagggaggccaaacgtcaccgtcccctgattgct
ctacccacccaagaccccgcccacgggggcgcccccccagagatggccagcaatcggaag
tga

DBGET integrated database retrieval system