KEGG   Homo sapiens (human): 3481Help
Entry
3481              CDS       T01001                                 

Gene name
IGF2, C11orf43, GRDF, IGF-II, PP9974
Definition
(RefSeq) insulin like growth factor 2
  KO
K13769  insulin-like growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05225  Hepatocellular carcinoma
Network
N00233  IGF2-IGF1R-RAS-ERK signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
Disease
H00033  Adrenal carcinoma
H00048  Hepatocellular carcinoma
H00711  Russell-Silver syndrome
H00713  Beckwith-Wiedemann syndrome
Drug target
Dusigitumab: D10352
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3481 (IGF2)
   04010 MAPK signaling pathway
    3481 (IGF2)
   04151 PI3K-Akt signaling pathway
    3481 (IGF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3481 (IGF2)
   05205 Proteoglycans in cancer
    3481 (IGF2)
   05225 Hepatocellular carcinoma
    3481 (IGF2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3481 (IGF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   3481 (IGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGF2_C Insulin
Motif
Other DBs
NCBI-GeneID: 3481
NCBI-ProteinID: NP_000603
OMIM: 147470
HGNC: 5466
Ensembl: ENSG00000129965 ENSG00000167244
Vega: OTTHUMG00000009395
Pharos: P01344(Tbio)
UniProt: P01344
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 180 aa AA seqDB search
MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcccaatggggaagtcgatgctggtgcttctcaccttcttggccttcgcctcg
tgctgcattgctgcttaccgccccagtgagaccctgtgcggcggggagctggtggacacc
ctccagttcgtctgtggggaccgcggcttctacttcagcaggcccgcaagccgtgtgagc
cgtcgcagccgtggcatcgttgaggagtgctgtttccgcagctgtgacctggccctcctg
gagacgtactgtgctacccccgccaagtccgagagggacgtgtcgacccctccgaccgtg
cttccggacaacttccccagataccccgtgggcaagttcttccaatatgacacctggaag
cagtccacccagcgcctgcgcaggggcctgcctgccctcctgcgtgcccgccggggtcac
gtgctcgccaaggagctcgaggcgttcagggaggccaaacgtcaccgtcccctgattgct
ctacccacccaagaccccgcccacgggggcgcccccccagagatggccagcaatcggaag
tga

DBGET integrated database retrieval system