KEGG   Homo sapiens (human): 36Help
Entry
36                CDS       T01001                                 

Gene name
ACADSB, 2-MEBCAD, ACAD7, SBCAD
Definition
acyl-CoA dehydrogenase, short/branched chain (EC:1.3.8.5)
Orthology
K09478  
short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Metabolic pathways
Fatty acid metabolism
Disease
H00525  
Disorders of fatty-acid oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    36 (ACADSB)
  Lipid metabolism
   00071 Fatty acid degradation
    36 (ACADSB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    36 (ACADSB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.12  2-methylacyl-CoA dehydrogenase
     36 (ACADSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13
AA seq 432 aa AA seqDB search
MEGLAVRLLRGSRLLRRNFLTCLSSWKIPPHVSKSSQSEALLNITNNGIHFAPLQTFTDE
EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLS
TVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAG
AGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRD
TPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQ
MLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAG
KPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQ
LNTIAKHIDAEY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagggcctggcagtgcggttgctgcgcggcagcaggctgctaagaagaaatttcctg
acttgtttgtcttcttggaagattcctcctcatgtctcaaaatcttcccagtcagaagct
ctactcaatataacaaataatggaatacactttgctcccctgcaaacatttacagatgag
gaaatgatgataaagagttcagttaaaaaatttgctcaggaacaaattgcacctttggtt
tcaaccatggatgaaaattcgaaaatggagaaatcagtaatacaaggattatttcaacaa
gggttgatgggtattgaagttgacccagaatatggaggcacaggagcttcatttttatcc
actgtgctcgtgatagaggaattagccaaagttgatgcatctgtggctgtcttttgtgag
atccagaacacattaattaacacactgattagaaaacatggaacagaagaacaaaaggcc
acctatttgcctcagctcactacagaaaaagtaggaagtttctgcctttcagaggctgga
gcaggtagtgactcatttgctttgaagaccagagctgataaagagggagattattatgtc
ctcaatggatcaaagatgtggatcagcagtgctgagcacgcagggctctttctggtgatg
gcaaatgtagaccctaccattggatataagggaattacctccttcttagtagatcgtgat
actccgggccttcatatagggaaacctgaaaacaaattggggctcagagcttcttccacc
tgcccgttaacattcgaaaatgtcaaggttccagaagccaatatcttgggacaaattgga
catggctataagtatgccatagggagtctcaatgaaggtagaataggaattgctgcacag
atgctgggactggcgcaaggatgttttgactacactattccatatattaaagaaaggata
caatttggcaaaagactatttgattttcagggcctccaacaccaagtggctcacgtggcc
acccagctggaagctgcaagattactaacatacaatgctgctaggcttttagaagctgga
aagccattcataaaagaagcgtcaatggccaaatactatgcatcagagattgcaggacaa
acaacgagtaaatgtatcgagtggatggggggagtaggctacaccaaagattaccctgtg
gagaaatacttccgagatgcaaagattggtacgatatatgaaggagcttccaacatccag
ttgaacaccattgcaaagcatatcgatgcagaatactga

DBGET integrated database retrieval system