KEGG   Homo sapiens (human): 3621Help
Entry
3621              CDS       T01001                                 

Gene name
ING1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Definition
(RefSeq) inhibitor of growth family member 1
  KO
K19197  
inhibitor of growth protein 1
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     3621 (ING1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 422 aa AA seqDB search
MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSL
GLQPWIGSSRCWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAW
RVSPRPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRG
WGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVE
LVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE
NRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQ
VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY
NR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgtggaatgtccttatcattcccctgcggaacgattggtcgctgaggcggat
gaaggcgggcctagcgcaataactggtatgggtctgtgtttccgctgtcttcttttttct
ttttcggggaggagcggggtggagggtggacgagttgatttgaacgtcttcgggtcgctc
ggcctccagccttggattggttcttctcgctgctggggcgggccgtgctcttccgccctg
cggtgtggttggttctcctcctggcctccgccctccaaatcggcgattcccataggcggc
ggctctcggggtgcggggcgagtctcccgctggcctcctccccattggctggaggcctgg
cgggtgtcgccccggcccctctccccgctcagcccggccactttcgggcgcggatttata
gcagtagcagtgatcccgggcctgtgggctcggggccggggctgcagttcggaccgcctc
ccgcgacccgcggggccggctcggagacagtttcaggccgcatctctgctgacccgaggg
tggggccgcgcgtggccgtggaaacagatcctgaaggagctagacgagtgctacgagcgc
ttcagtcgcgagacagacggggcgcagaagcggcggatgctgcactgtgtgcagcgcgcg
ctgatccgcagccaggagctgggcgacgagaagatccagatcgtgagccagatggtggag
ctggtggagaaccgcacgcggcaggtggacagccacgtggagctgttcgaggcgcagcag
gagctgggcgacacagcgggcaacagcggcaaggctggcgcggacaggcccaaaggcgag
gcggcagcgcaggctgacaagcccaacagcaagcgctcacggcggcagcgcaacaacgag
aaccgtgagaacgcgtccagcaaccacgaccacgacgacggcgcctcgggcacacccaag
gagaagaaggccaagacctccaagaagaagaagcgctccaaggccaaggcggagcgagag
gcgtcccctgccgacctccccatcgaccccaacgaacccacgtactgtctgtgcaaccag
gtctcctatggggagatgatcggctgcgacaacgacgagtgccccatcgagtggttccac
ttctcgtgcgtggggctcaatcataaacccaagggcaagtggtactgtcccaagtgccgg
ggggagaacgagaagaccatggacaaagccctggagaaatccaaaaaagagagggcttac
aacaggtag

DBGET integrated database retrieval system