KEGG   Homo sapiens (human): 3767Help
Entry
3767              CDS       T01001                                 

Gene name
KCNJ11, BIR, HHF2, IKATP, KIR6.2, MODY13, PHHI, TNDM3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 11
  KO
K05004  
potassium inwardly-rectifying channel subfamily J member 11
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Type II diabetes mellitus
Disease
H00409  
Type II diabetes mellitus
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00513  
Transient neonatal diabetes mellitus (TNDM)
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Glibenclamide: 
Tolbutamide: 
Amiodarone: 
Tedisamil: 
Dronedarone: 
Nicorandil: 
Diazoxide: 
Minoxidil: 
Pinacidil: 
Bepridil: 
Tolbutamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3767 (KCNJ11)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3767 (KCNJ11)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3767 (KCNJ11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.1
AA seq 303 aa AA seqDB search
MAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAIL
ILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRK
SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPL
YDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYS
VDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPD
SLS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtggctcatcgccttcgcccacggtgacctggcccccagcgagggcactgct
gagccctgtgtcaccagcatccactccttctcgtctgccttccttttctccattgaggtc
caagtgactattggctttggggggcgcatggtgactgaggagtgcccactggccatcctg
atcctcatcgtgcagaacatcgtggggctcatgatcaacgccatcatgcttggctgcatc
ttcatgaagactgcccaagcccaccgcagggctgagaccctcatcttcagcaagcatgcg
gtgatcgccctgcgccacggccgcctctgcttcatgctacgtgtgggtgacctccgcaag
agcatgatcatcagcgccaccatccacatgcaggtggtacgcaagaccaccagccccgag
ggcgaggtggtgcccctccaccaggtggacatccccatggagaacggcgtgggtggcaac
agcatcttcctggtggccccgctgatcatctaccatgtcattgatgccaacagcccactc
tacgacctggcacccagcgacctgcaccaccaccaggacctcgagatcatcgtcatcctg
gaaggcgtggtggaaaccacgggcatcaccacccaggcccgcacctcctacctggccgat
gagatcctgtggggccagcgctttgtgcccattgtagctgaggaggacggacgttactct
gtggactactccaagtttggcaacaccgtcaaagtgcccacaccactctgcacggcccgc
cagcttgatgaggaccacagcctactggaagctctgaccctcgcctcagcccgcgggccc
ctgcgcaagcgcagcgtgcccatggccaaggccaagcccaagttcagcatctctccagat
tccctgtcctga

DBGET integrated database retrieval system