KEGG   Homo sapiens (human): 3848Help
Entry
3848              CDS       T01001                                 

Gene name
KRT1, CK1, EHK, EHK1, EPPK, K1, KRT1A, NEPPK
Definition
keratin 1
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00691  
Epidermolytic hyperkeratosis (EHK)
H00707  
Ichthyosis hystrix, Curth-Macklin type
H00717  
Striate palmoplantar keratoderma
H00722  
Epidermolytic palmoplantar keratoderma (EPPK)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 644 aa AA seqDB search
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG
GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE
REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR
RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD
LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED
IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA
TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG
SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG
GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgacagtttagttccaggtctgggtaccgaagtggagggggcttcagctctggc
tctgctgggatcatcaactaccagcgcaggaccaccagcagctccacacgccgcagtgga
ggaggtggtgggagattttcaagctgtggtggtggtggtggtagctttggtgctggtggt
ggatttggaagtcggagtcttgttaaccttggtggcagtaaaagcatctccataagtgtg
gctagaggaggtggacgtggtagtggctttggtggtggttatggtggtggtggctttggt
ggtggtggctttggtggtggtggctttggtggaggtggcattgggggtggtggctttggt
ggttttggcagtggtggtggtggttttggtggaggtggctttgggggtggtggatatggg
ggtggttatggtcctgtctgccctcctggtggcatacaagaagtcactatcaaccagagc
cttcttcagcccctcaatgtggagattgaccctgagatccaaaaggtgaagtctcgagaa
agggagcaaatcaagtcactcaacaaccaatttgcctccttcattgacaaggtgaggttc
ctggagcagcagaaccaggtactgcaaacaaaatgggagctgctgcagcaggtagatacc
tccactagaacccataatttagagccctactttgagtcattcatcaacaatctccgaagg
agagtggaccaactgaagagtgatcaatctcggttggattcggaactgaagaacatgcag
gacatggtggaggattaccggaacaagtatgaggatgaaatcaacaagcggacaaatgca
gagaatgaatttgtgaccatcaagaaggatgtggatggtgcttatatgaccaaggtggac
cttcaggccaaacttgacaacttgcagcaggaaattgatttccttacagcactctaccaa
gcagagttgtctcagatgcagactcaaatcagtgaaactaatgtcatcctctctatggac
aacaaccgcagtctcgacctggacagcatcattgctgaggtcaaggcccagtacgaggat
atagcccagaagagcaaagctgaggccgagtccttgtaccagagcaagtatgaagagctg
cagatcactgctggcagacatggggatagtgtgagaaattcaaagatagaaatttctgag
ctgaatcgtgtgatccagagacttagatctgaaatcgacaatgtcaagaagcagatctcc
aacttgcagcagtccatcagtgatgcagagcagcgtggcgagaatgccctcaaggatgcc
aagaacaagctgaatgacctggaggatgccctgcagcaggccaaggaagacctggcccgc
ctgctgcgcgactaccaggagctgatgaacaccaagctggccctggatctggagattgcc
acctacaggaccctcctggagggagaagaaagcaggatgtctggagaatgtgccccgaac
gtgagtgtgtctgtgagcacaagccacaccaccatcagtggaggtggcagccgaggaggt
ggcggcggtggctacggctctggaggtagcagctatggctccggaggtggtagctatggt
tctggaggtggcggcggcggcggccgtggcagctatggctccggaggtagcagctacggc
tccggaggtggcagctatggctctggaggtggcggcggcggccatggcagctacggctcc
ggaagcagcagtgggggctacagaggtggctctggaggcggcggcggcggcagctctggc
ggccggggctctggcggcgggagctctggaggctccataggaggccggggatccagctct
gggggtgtcaagtcctctggtggcagttccagcgtgaagtttgtttctaccacttattcc
ggagtaaccagataa

DBGET integrated database retrieval system