KEGG   Homo sapiens (human): 3848Help
Entry
3848              CDS       T01001                                 

Gene name
KRT1, CK1, EHK, EHK1, EPPK, K1, KRT1A, NEPPK
Definition
keratin 1
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00691  
Epidermolytic hyperkeratosis (EHK)
H00707  
Ichthyosis hystrix, Curth-Macklin type
H00717  
Striate palmoplantar keratoderma
H00722  
Epidermolytic palmoplantar keratoderma (EPPK)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3848 (KRT1)
  Exosomal proteins of other body fluids (saliva and urine)
   3848 (KRT1)
  Exosomal proteins of colorectal cancer cells
   3848 (KRT1)
  Exosomal proteins of bladder cancer cells
   3848 (KRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 644 aa AA seqDB search
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG
GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE
REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR
RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD
LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED
IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA
TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG
SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG
GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgacagtttagttccaggtctgggtaccgaagtggagggggcttcagctctggc
tctgctgggatcatcaactaccagcgcaggaccaccagcagctccacacgccgcagtgga
ggaggtggtgggagattttcaagctgtggtggtggtggtggtagctttggtgctggtggt
ggatttggaagtcggagtcttgttaaccttggtggcagtaaaagcatctccataagtgtg
gctagaggaggtggacgtggtagtggctttggtggtggttatggtggtggtggctttggt
ggtggtggctttggtggtggtggctttggtggaggtggcattgggggtggtggctttggt
ggttttggcagtggtggtggtggttttggtggaggtggctttgggggtggtggatatggg
ggtggttatggtcctgtctgccctcctggtggcatacaagaagtcactatcaaccagagc
cttcttcagcccctcaatgtggagattgaccctgagatccaaaaggtgaagtctcgagaa
agggagcaaatcaagtcactcaacaaccaatttgcctccttcattgacaaggtgaggttc
ctggagcagcagaaccaggtactgcaaacaaaatgggagctgctgcagcaggtagatacc
tccactagaacccataatttagagccctactttgagtcattcatcaacaatctccgaagg
agagtggaccaactgaagagtgatcaatctcggttggattcggaactgaagaacatgcag
gacatggtggaggattaccggaacaagtatgaggatgaaatcaacaagcggacaaatgca
gagaatgaatttgtgaccatcaagaaggatgtggatggtgcttatatgaccaaggtggac
cttcaggccaaacttgacaacttgcagcaggaaattgatttccttacagcactctaccaa
gcagagttgtctcagatgcagactcaaatcagtgaaactaatgtcatcctctctatggac
aacaaccgcagtctcgacctggacagcatcattgctgaggtcaaggcccagtacgaggat
atagcccagaagagcaaagctgaggccgagtccttgtaccagagcaagtatgaagagctg
cagatcactgctggcagacatggggatagtgtgagaaattcaaagatagaaatttctgag
ctgaatcgtgtgatccagagacttagatctgaaatcgacaatgtcaagaagcagatctcc
aacttgcagcagtccatcagtgatgcagagcagcgtggcgagaatgccctcaaggatgcc
aagaacaagctgaatgacctggaggatgccctgcagcaggccaaggaagacctggcccgc
ctgctgcgcgactaccaggagctgatgaacaccaagctggccctggatctggagattgcc
acctacaggaccctcctggagggagaagaaagcaggatgtctggagaatgtgccccgaac
gtgagtgtgtctgtgagcacaagccacaccaccatcagtggaggtggcagccgaggaggt
ggcggcggtggctacggctctggaggtagcagctatggctccggaggtggtagctatggt
tctggaggtggcggcggcggcggccgtggcagctatggctccggaggtagcagctacggc
tccggaggtggcagctatggctctggaggtggcggcggcggccatggcagctacggctcc
ggaagcagcagtgggggctacagaggtggctctggaggcggcggcggcggcagctctggc
ggccggggctctggcggcgggagctctggaggctccataggaggccggggatccagctct
gggggtgtcaagtcctctggtggcagttccagcgtgaagtttgtttctaccacttattcc
ggagtaaccagataa

DBGET integrated database retrieval system