KEGG   Homo sapiens (human): 3850Help
Entry
3850              CDS       T01001                                 

Gene name
KRT3, CK3, K3
Definition
keratin 3
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00726  
Meesmann corneal dystrophy
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 628 aa AA seqDB search
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL
GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG
GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL
QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS
ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA
ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD
NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR
LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG
GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS
GGGFSSASNRGGSIKFSQSSQSSQRYSR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaagccagcaagacatctggtggcgggagccagggtttctccggccgctct
gctgtggtctccggcagcagcaggatgagctgtgtggcccactctgggggagctggcgga
ggggcctatggcttccggagcggagcaggtggctttggcagtcgcagcctctacaacctg
ggcggcaacaagagcatctccatcagcgtggcagctggcggctcccgggctggaggcttt
gggggagggcggagcagctgtgcctttgcaggtggctatggaggtggctttgggagcggc
tatggaggtggctttggtggtggctttggtggtggcagaggaatgggaggtggctttggt
ggagctggtggctttggaggggctggtggctttggaggggctggtggctttggtggtcct
ggtggctttggtgggtctggtggctttggtgggcctggcagcttgggcagtcctggtggc
tttggccctgggggctttcctgggggaattcaggaagtgactatcaaccagagtctcctg
cagcccctcaatgtggagatcgacccccagattgggcaagtaaaggcccaggagcgggaa
cagatcaagaccctcaacaacaagtttgcctccttcattgacaaggtgcggttcctggag
caacagaacaaagtcctggagaccaagtggaacctgctccagcagcagggcacaagttcc
atctcaggcacaaacaaccttgagcctctttttgagaatcacatcaactacctgcggagc
tacctggacaacatcctcggggagagagggcgcctggactctgagctgaagaacatggag
gacctggtggaagacttcaagaagaaatatgaggatgaaatcaataaacgtacagctgct
gagaatgaatttgtgactctgaagaaggatgtggacagtgcctatatgaacaaggtggag
cttcaggccaaagtggatgccttgatagatgagatcgacttcttaaggaccctctacgac
gctgagctatctcagatgcagagccacatcagtgacacatctgtggtgctgtccatggac
aataatcgctccctggacctggacagcatcattgctgaagttcgtgcacagtatgaggat
atcgctcagagaagcaaggccgaagctgaggccctgtaccagaccaagttgggggagctg
cagaccacggctggcaggcatggggatgacctaagaaataccaagagcgagatcatagag
ctcaacagaatgatccagaggctgcgggcagagatcgagggtgtcaagaagcagaatgcc
aacctgcagacggccattgccgaggccgagcagcatggagagatggccctcaaggatgcc
aatgccaagctccaagagctgcaggctgctctacagcaggcgaaggatgacctggcgcgg
ctgctacgtgactaccaggagctgatgaatgtcaagctggccctggacgtggagatcgcc
acctaccgcaagctgctggagggcgaggagtacaggatgtctggagagtgtccgagtgct
gtcagcatctccgtggtcagcagcagcacgacttccgcctccgcaggtggctatggagga
ggttacggcggaggcatgggcggtggtttaggaggtggcttcagtgcgggcggcggctca
ggcagtggctttggccggggaggcggcggtggaatcggcggtggatttggcggcggcagc
agcggtttcagcggtggcagcggctttggctccatctctggcgcccgctatggagtcagt
ggcgggggcttcagctcggccagcaaccggggcggcagcatcaagttctcccagtcctcc
cagtcctcccagcgctactccagataa

DBGET integrated database retrieval system