KEGG   Homo sapiens (human): 3850Help
Entry
3850              CDS       T01001                                 

Gene name
KRT3, CK3, K3
Definition
(RefSeq) keratin 3
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00726  Meesmann corneal dystrophy
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3850 (KRT3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3850 (KRT3)
  Exosomal proteins of other body fluids (saliva and urine)
   3850 (KRT3)
  Exosomal proteins of colorectal cancer cells
   3850 (KRT3)
  Exosomal proteins of bladder cancer cells
   3850 (KRT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 Spc7 ATG16 ZapB Reo_sigmaC ADIP Jnk-SapK_ap_N SHE3 DUF4407 DUF948 MCC-bdg_PDZ IncA Alanine_zipper
Motif
Other DBs
NCBI-GeneID: 3850
NCBI-ProteinID: NP_476429
OMIM: 148043
HGNC: 6440
Ensembl: ENSG00000186442
Vega: OTTHUMG00000169799
Pharos: P12035(Tbio)
UniProt: P12035
Position
12q13.13
AA seq 628 aa AA seqDB search
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL
GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG
GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL
QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS
ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA
ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD
NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR
LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG
GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS
GGGFSSASNRGGSIKFSQSSQSSQRYSR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaagccagcaagacatctggtggcgggagccagggtttctccggccgctct
gctgtggtctccggcagcagcaggatgagctgtgtggcccactctgggggagctggcgga
ggggcctatggcttccggagcggagcaggtggctttggcagtcgcagcctctacaacctg
ggcggcaacaagagcatctccatcagcgtggcagctggcggctcccgggctggaggcttt
gggggagggcggagcagctgtgcctttgcaggtggctatggaggtggctttgggagcggc
tatggaggtggctttggtggtggctttggtggtggcagaggaatgggaggtggctttggt
ggagctggtggctttggaggggctggtggctttggaggggctggtggctttggtggtcct
ggtggctttggtgggtctggtggctttggtgggcctggcagcttgggcagtcctggtggc
tttggccctgggggctttcctgggggaattcaggaagtgactatcaaccagagtctcctg
cagcccctcaatgtggagatcgacccccagattgggcaagtaaaggcccaggagcgggaa
cagatcaagaccctcaacaacaagtttgcctccttcattgacaaggtgcggttcctggag
caacagaacaaagtcctggagaccaagtggaacctgctccagcagcagggcacaagttcc
atctcaggcacaaacaaccttgagcctctttttgagaatcacatcaactacctgcggagc
tacctggacaacatcctcggggagagagggcgcctggactctgagctgaagaacatggag
gacctggtggaagacttcaagaagaaatatgaggatgaaatcaataaacgtacagctgct
gagaatgaatttgtgactctgaagaaggatgtggacagtgcctatatgaacaaggtggag
cttcaggccaaagtggatgccttgatagatgagatcgacttcttaaggaccctctacgac
gctgagctatctcagatgcagagccacatcagtgacacatctgtggtgctgtccatggac
aataatcgctccctggacctggacagcatcattgctgaagttcgtgcacagtatgaggat
atcgctcagagaagcaaggccgaagctgaggccctgtaccagaccaagttgggggagctg
cagaccacggctggcaggcatggggatgacctaagaaataccaagagcgagatcatagag
ctcaacagaatgatccagaggctgcgggcagagatcgagggtgtcaagaagcagaatgcc
aacctgcagacggccattgccgaggccgagcagcatggagagatggccctcaaggatgcc
aatgccaagctccaagagctgcaggctgctctacagcaggcgaaggatgacctggcgcgg
ctgctacgtgactaccaggagctgatgaatgtcaagctggccctggacgtggagatcgcc
acctaccgcaagctgctggagggcgaggagtacaggatgtctggagagtgtccgagtgct
gtcagcatctccgtggtcagcagcagcacgacttccgcctccgcaggtggctatggagga
ggttacggcggaggcatgggcggtggtttaggaggtggcttcagtgcgggcggcggctca
ggcagtggctttggccggggaggcggcggtggaatcggcggtggatttggcggcggcagc
agcggtttcagcggtggcagcggctttggctccatctctggcgcccgctatggagtcagt
ggcgggggcttcagctcggccagcaaccggggcggcagcatcaagttctcccagtcctcc
cagtcctcccagcgctactccagataa

DBGET integrated database retrieval system