KEGG   Homo sapiens (human): 3850Help
Entry
3850              CDS       T01001                                 

Gene name
KRT3, CK3, K3
Definition
keratin 3
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00726  
Meesmann corneal dystrophy
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3850 (KRT3)
  Exosomal proteins of other body fluids (saliva and urine)
   3850 (KRT3)
  Exosomal proteins of colorectal cancer cells
   3850 (KRT3)
  Exosomal proteins of bladder cancer cells
   3850 (KRT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 628 aa AA seqDB search
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL
GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG
GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL
QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS
ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA
ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD
NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR
LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG
GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS
GGGFSSASNRGGSIKFSQSSQSSQRYSR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaagccagcaagacatctggtggcgggagccagggtttctccggccgctct
gctgtggtctccggcagcagcaggatgagctgtgtggcccactctgggggagctggcgga
ggggcctatggcttccggagcggagcaggtggctttggcagtcgcagcctctacaacctg
ggcggcaacaagagcatctccatcagcgtggcagctggcggctcccgggctggaggcttt
gggggagggcggagcagctgtgcctttgcaggtggctatggaggtggctttgggagcggc
tatggaggtggctttggtggtggctttggtggtggcagaggaatgggaggtggctttggt
ggagctggtggctttggaggggctggtggctttggaggggctggtggctttggtggtcct
ggtggctttggtgggtctggtggctttggtgggcctggcagcttgggcagtcctggtggc
tttggccctgggggctttcctgggggaattcaggaagtgactatcaaccagagtctcctg
cagcccctcaatgtggagatcgacccccagattgggcaagtaaaggcccaggagcgggaa
cagatcaagaccctcaacaacaagtttgcctccttcattgacaaggtgcggttcctggag
caacagaacaaagtcctggagaccaagtggaacctgctccagcagcagggcacaagttcc
atctcaggcacaaacaaccttgagcctctttttgagaatcacatcaactacctgcggagc
tacctggacaacatcctcggggagagagggcgcctggactctgagctgaagaacatggag
gacctggtggaagacttcaagaagaaatatgaggatgaaatcaataaacgtacagctgct
gagaatgaatttgtgactctgaagaaggatgtggacagtgcctatatgaacaaggtggag
cttcaggccaaagtggatgccttgatagatgagatcgacttcttaaggaccctctacgac
gctgagctatctcagatgcagagccacatcagtgacacatctgtggtgctgtccatggac
aataatcgctccctggacctggacagcatcattgctgaagttcgtgcacagtatgaggat
atcgctcagagaagcaaggccgaagctgaggccctgtaccagaccaagttgggggagctg
cagaccacggctggcaggcatggggatgacctaagaaataccaagagcgagatcatagag
ctcaacagaatgatccagaggctgcgggcagagatcgagggtgtcaagaagcagaatgcc
aacctgcagacggccattgccgaggccgagcagcatggagagatggccctcaaggatgcc
aatgccaagctccaagagctgcaggctgctctacagcaggcgaaggatgacctggcgcgg
ctgctacgtgactaccaggagctgatgaatgtcaagctggccctggacgtggagatcgcc
acctaccgcaagctgctggagggcgaggagtacaggatgtctggagagtgtccgagtgct
gtcagcatctccgtggtcagcagcagcacgacttccgcctccgcaggtggctatggagga
ggttacggcggaggcatgggcggtggtttaggaggtggcttcagtgcgggcggcggctca
ggcagtggctttggccggggaggcggcggtggaatcggcggtggatttggcggcggcagc
agcggtttcagcggtggcagcggctttggctccatctctggcgcccgctatggagtcagt
ggcgggggcttcagctcggccagcaaccggggcggcagcatcaagttctcccagtcctcc
cagtcctcccagcgctactccagataa

DBGET integrated database retrieval system