KEGG   Homo sapiens (human): 3854Help
Entry
3854              CDS       T01001                                 

Gene name
KRT6B, CK-6B, CK6B, K6B, KRTL1, PC2, PC4
Definition
keratin 6B
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00684  
Pachyonychia congenita
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3854 (KRT6B)
  Exosomal proteins of other body fluids (saliva and urine)
   3854 (KRT6B)
  Exosomal proteins of colorectal cancer cells
   3854 (KRT6B)
  Exosomal proteins of bladder cancer cells
   3854 (KRT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 564 aa AA seqDB search
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELR
NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacatccaccaccatcaggagccacagcagcagccgccggggtttcagtgcc
aactcagccaggctccctggggtcagccgctctggcttcagcagcatctccgtgtcccgc
tccaggggcagtggtggcctgggtggcgcatgtggaggagctggctttggcagccgcagt
ctgtatggcctggggggctccaagaggatctccattggagggggcagctgtgccatcagt
ggcggctatggcagcagagccggaggcagctatggctttggtggcgccgggagtggattt
ggtttcggtggtggagccggcattggctttggtctgggtggtggagccggccttgctggt
ggctttgggggccctggcttccctgtgtgcccccctggaggcatccaagaggtcactgtc
aaccagagtctcctgactcccctcaacctgcaaattgaccccgccatccagcgggtgcgg
gccgaggagcgtgagcagatcaagaccctcaacaacaagtttgcctccttcatcgacaag
gtgcggttcctagagcagcagaacaaggttctggacaccaagtggaccctgctgcaggag
cagggcaccaagactgtgaggcagaacctggagccgttgttcgagcagtacatcaacaac
ctcaggaggcagctggacaacatcgtgggggaacggggtcgtctggactcggagctgaga
aacatgcaggacctggtggaggacctcaagaacaaatatgaggatgaaatcaacaagcgc
acagcagcagagaatgaatttgtgactctgaagaaggatgtggatgctgcctacatgaac
aaggttgaactgcaagccaaggcagacactcttacagatgagatcaacttcctgagagcc
ttgtatgatgcagagctgtcccagatgcagacccacatctcagacacatccgtggtgcta
tccatggacaacaaccgcaacctggacctggacagcatcatcgctgaggtcaaggcccaa
tatgaggagattgctcagaggagcagggctgaggctgagtcctggtaccagacaaagtac
gaggagctgcagatcacagcaggcagacatggggacgacctgcgcaacaccaagcaggag
attgctgagatcaaccgcatgatccagaggctgagatctgagatcgaccacgtcaagaag
cagtgtgccaacctacaggccgccattgctgatgctgagcagcgtggggagatggccctc
aaggatgctaagaacaagctggaagggctggaggatgccctgcagaaggccaagcaggac
ctggcccggctgctgaaggagtaccaggagctgatgaacgtcaagctggccctggatgtg
gagatcgccacctaccgcaagctgctggagggcgaggagtgcaggctgaatggcgaaggc
gttggacaagtcaacatctctgtagtgcagtccaccgtctccagtggctatggcggtgcc
agcggtgtcggcagtggcttaggcctgggtggaggaagcagctactcctatggcagtggt
cttggcgttggaggcggctttagttccagcagcggcagagccactgggggtggcctcagc
tctgttggaggcggcagttccaccatcaagtacaccaccacctcctcctccagcaggaag
agctacaagcactga

DBGET integrated database retrieval system