KEGG   Homo sapiens (human): 3854Help
Entry
3854              CDS       T01001                                 

Gene name
KRT6B, CK-6B, CK6B, K6B, KRTL1, PC2
Definition
keratin 6B
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00684  
Pachyonychia congenita
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 564 aa AA seqDB search
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELR
NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacatccaccaccatcaggagccacagcagcagccgccggggtttcagtgcc
aactcagccaggctccctggggtcagccgctctggcttcagcagcatctccgtgtcccgc
tccaggggcagtggtggcctgggtggcgcatgtggaggagctggctttggcagccgcagt
ctgtatggcctggggggctccaagaggatctccattggagggggcagctgtgccatcagt
ggcggctatggcagcagagccggaggcagctatggctttggtggcgccgggagtggattt
ggtttcggtggtggagccggcattggctttggtctgggtggtggagccggccttgctggt
ggctttgggggccctggcttccctgtgtgcccccctggaggcatccaagaggtcactgtc
aaccagagtctcctgactcccctcaacctgcaaattgaccccgccatccagcgggtgcgg
gccgaggagcgtgagcagatcaagaccctcaacaacaagtttgcctccttcatcgacaag
gtgcggttcctagagcagcagaacaaggttctggacaccaagtggaccctgctgcaggag
cagggcaccaagactgtgaggcagaacctggagccgttgttcgagcagtacatcaacaac
ctcaggaggcagctggacaacatcgtgggggaacggggtcgtctggactcggagctgaga
aacatgcaggacctggtggaggacctcaagaacaaatatgaggatgaaatcaacaagcgc
acagcagcagagaatgaatttgtgactctgaagaaggatgtggatgctgcctacatgaac
aaggttgaactgcaagccaaggcagacactcttacagatgagatcaacttcctgagagcc
ttgtatgatgcagagctgtcccagatgcagacccacatctcagacacatccgtggtgcta
tccatggacaacaaccgcaacctggacctggacagcatcatcgctgaggtcaaggcccaa
tatgaggagattgctcagaggagcagggctgaggctgagtcctggtaccagacaaagtac
gaggagctgcagatcacagcaggcagacatggggacgacctgcgcaacaccaagcaggag
attgctgagatcaaccgcatgatccagaggctgagatctgagatcgaccacgtcaagaag
cagtgtgccaacctacaggccgccattgctgatgctgagcagcgtggggagatggccctc
aaggatgctaagaacaagctggaagggctggaggatgccctgcagaaggccaagcaggac
ctggcccggctgctgaaggagtaccaggagctgatgaacgtcaagctggccctggatgtg
gagatcgccacctaccgcaagctgctggagggcgaggagtgcaggctgaatggcgaaggc
gttggacaagtcaacatctctgtagtgcagtccaccgtctccagtggctatggcggtgcc
agcggtgtcggcagtggcttaggcctgggtggaggaagcagctactcctatggcagtggt
cttggcgttggaggcggctttagttccagcagcggcagagccactgggggtggcctcagc
tctgttggaggcggcagttccaccatcaagtacaccaccacctcctcctccagcaggaag
agctacaagcactga

DBGET integrated database retrieval system