KEGG   Homo sapiens (human): 3868Help
Entry
3868              CDS       T01001                                 

Gene name
KRT16, CK16, FNEPPK, K16, K1CP, KRT16A, NEPPK
Definition
keratin 16
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Disease
H00684  
Pachyonychia congenita
H00723  
Non-epidermolytic palmoplantar keratoderma (NEPPK)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 473 aa AA seqDB search
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctgcagccgccagttcacctcctccagctccatgaagggctcctgcggcatc
ggaggcggcatcgggggcggctccagccgcatctcctccgtcctggccggagggtcctgc
cgtgcccccagcacctacgggggcggcctgtctgtctcctctcgcttctcctctggggga
gcctgcgggctggggggcggctatggcggtggcttcagcagcagcagcagctttggtagt
ggcttcgggggaggatatggtggtggccttggtgctggcttcggtggtggcttgggtgct
ggctttggtggtggttttgctggtggtgatgggcttctggtgggcagtgagaaggtgacc
atgcagaacctcaatgaccgcctggcctcctacctggacaaggtgcgtgctctggaggag
gccaacgccgacctggaagtgaagatccgtgactggtaccagaggcagcggcccagtgag
atcaaagactacagtccctacttcaagaccatcgaggacctgaggaacaagatcattgcg
gccaccattgagaatgcgcagcccattttgcagattgacaatgccaggctggcagccgat
gacttcaggaccaagtatgagcatgaactggccctgcggcagactgtggaggccgacgtc
aatggcctgcgccgggtgttggatgagctgaccctggccaggactgacctggagatgcag
atcgaaggcctgaaggaggagctggcctacctgaggaagaaccacgaggaggagatgctt
gctctgagaggtcagaccggcggagatgtgaacgtggagatggatgctgcacctggcgtg
gacctgagccgcatcctgaatgagatgcgtgaccagtacgagcagatggcagagaaaaac
cgcagagacgctgagacctggttcctgagcaagaccgaggagctgaacaaagaagtggcc
tccaacagcgaactggtacagagcagccgcagtgaggtgacggagctccggagggtgctc
cagggcctggagattgagctgcagtcccagctcagcatgaaagcatccctggagaacagc
ctggaggagaccaaaggccgctactgcatgcagctgtcccagatccagggactgattggc
agtgtggaggagcagctggcccagctacgctgtgagatggagcagcagagccaggagtac
cagatcttgctggatgtgaagacgcggctggagcaggagattgccacctaccgccgcctg
ctggagggcgaggatgcccacctttcctcccagcaagcatctggccaatcctattcttcc
cgcgaggtcttcacctcctcctcgtcctcttcgagccgtcagacccggcccatcctcaag
gagcagagctcatccagcttcagccagggccagagctcctag

DBGET integrated database retrieval system