KEGG   Homo sapiens (human): 3868Help
Entry
3868              CDS       T01001                                 

Gene name
KRT16, CK16, FNEPPK, K16, K1CP, KRT16A, NEPPK, PC1
Definition
keratin 16
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Disease
H00684  
Pachyonychia congenita
H00723  
Non-epidermolytic palmoplantar keratoderma (NEPPK)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3868 (KRT16)
  Exosomal proteins of other body fluids (saliva and urine)
   3868 (KRT16)
  Exosomal proteins of colorectal cancer cells
   3868 (KRT16)
  Exosomal proteins of melanoma cells
   3868 (KRT16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 473 aa AA seqDB search
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctgcagccgccagttcacctcctccagctccatgaagggctcctgcggcatc
ggaggcggcatcgggggcggctccagccgcatctcctccgtcctggccggagggtcctgc
cgtgcccccagcacctacgggggcggcctgtctgtctcctctcgcttctcctctggggga
gcctgcgggctggggggcggctatggcggtggcttcagcagcagcagcagctttggtagt
ggcttcgggggaggatatggtggtggccttggtgctggcttcggtggtggcttgggtgct
ggctttggtggtggttttgctggtggtgatgggcttctggtgggcagtgagaaggtgacc
atgcagaacctcaatgaccgcctggcctcctacctggacaaggtgcgtgctctggaggag
gccaacgccgacctggaagtgaagatccgtgactggtaccagaggcagcggcccagtgag
atcaaagactacagtccctacttcaagaccatcgaggacctgaggaacaagatcattgcg
gccaccattgagaatgcgcagcccattttgcagattgacaatgccaggctggcagccgat
gacttcaggaccaagtatgagcatgaactggccctgcggcagactgtggaggccgacgtc
aatggcctgcgccgggtgttggatgagctgaccctggccaggactgacctggagatgcag
atcgaaggcctgaaggaggagctggcctacctgaggaagaaccacgaggaggagatgctt
gctctgagaggtcagaccggcggagatgtgaacgtggagatggatgctgcacctggcgtg
gacctgagccgcatcctgaatgagatgcgtgaccagtacgagcagatggcagagaaaaac
cgcagagacgctgagacctggttcctgagcaagaccgaggagctgaacaaagaagtggcc
tccaacagcgaactggtacagagcagccgcagtgaggtgacggagctccggagggtgctc
cagggcctggagattgagctgcagtcccagctcagcatgaaagcatccctggagaacagc
ctggaggagaccaaaggccgctactgcatgcagctgtcccagatccagggactgattggc
agtgtggaggagcagctggcccagctacgctgtgagatggagcagcagagccaggagtac
cagatcttgctggatgtgaagacgcggctggagcaggagattgccacctaccgccgcctg
ctggagggcgaggatgcccacctttcctcccagcaagcatctggccaatcctattcttcc
cgcgaggtcttcacctcctcctcgtcctcttcgagccgtcagacccggcccatcctcaag
gagcagagctcatccagcttcagccagggccagagctcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system