KEGG   Homo sapiens (human): 3887Help
Entry
3887              CDS       T01001                                 

Gene name
KRT81, HB1, Hb-1, KRTHB1, MLN137, ghHkb1, hHAKB2-1
Definition
keratin 81
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00670  
Monilethrix
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 505 aa AA seqDB search
MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGG
GSCGVGSCGISSLGVGSCGSSCRKC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcggatcaggatttggtgggcgcgccttcagctgcatctcggcctgcgggccg
cggcccggccgctgctgcatcaccgccgccccctaccgtggcatctcctgctaccgcggc
ctcaccgggggcttcggcagccacagcgtgtgcggaggctttcgggccggctcctgcgga
cgcagcttcggctaccgctccgggggcgtgtgcgggcccagtcccccatgcatcaccacc
gtgtcggtcaacgagagcctcctcacgcccctcaacctggagatcgaccccaacgcgcag
tgcgtgaagcaggaggagaaggagcagatcaagtccctcaacagcaggttcgcggccttc
atcgacaaggtgcgcttcctggagcagcagaacaaactgctggagacaaagctgcagttc
taccagaaccgcgagtgttgccagagcaacctggagcccctgtttgagggctacatcgag
actctgcggcgggaggccgagtgcgtggaggccgacagcgggaggctggcctcagagctt
aaccacgtgcaggaggtgctggagggctacaagaagaagtatgaggaggaggtttctctg
agagcaacagctgagaacgagtttgtggctctgaagaaggatgtggactgcgcctacctc
cgcaagtcagacctggaggccaacgtggaggccctgatccaggagatcgacttcctgagg
cggctgtatgaggaggagatcctcattctccagtcgcacatctcagacacctccgtggtt
gtcaagctggacaacagccgggacctgaacatggactgcatcattgccgagattaaggca
cagtatgacgacattgtcacccgcagccgggccgaggccgagtcctggtaccgcagcaag
tgtgaggagatgaaggccacggtgatcaggcacggggagaccctgcgccgcaccaaggag
gagatcaatgagctgaaccgcatgatccaaaggctgacggccgaggtggagaatgccaag
tgccagaactccaagctggaggccgcggtggcccagtctgagcagcagggtgaggcggcc
ctcagtgatgcccgctgcaagctggccgagctggagggcgccctgcagaaggccaagcag
gacatggcctgcctgatcagggagtaccaggaggtgatgaactccaagctgggcctggac
atcgagatcgccacctacaggcgcctgctggagggcgaggagcagaggctatgtgaaggc
attggggctgtgaatgtctgtgtcagcagctcccggggcggggtcgtgtgcggggacctc
tgcgtgtcaggctcccggccagtgactggcagtgtctgcagcgctccgtgcaacgggaac
gtggcggtgagcaccggcctgtgtgcgccctgcggccaattgaacaccacctgcggaggg
ggttcctgcggcgtgggctcctgtggtatcagctccctgggtgtggggtcttgcggcagc
agctgccggaaatgttag

DBGET integrated database retrieval system