KEGG   Homo sapiens (human): 3889Help
Entry
3889              CDS       T01001                                 

Gene name
KRT83, EKVP5, HB3, Hb-3, KRTHB3, MNLIX
Definition
(RefSeq) keratin 83
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00670  Monilethrix
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3889 (KRT83)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3889 (KRT83)
  Exosomal proteins of other body fluids (saliva and urine)
   3889 (KRT83)
  Exosomal proteins of colorectal cancer cells
   3889 (KRT83)
  Exosomal proteins of bladder cancer cells
   3889 (KRT83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 DUF4924 BAT Spc7 DUF885 DUF1635 Glutaredoxin2_C Spc42p CENP-F_leu_zip Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 3889
NCBI-ProteinID: NP_002273
OMIM: 602765
HGNC: 6460
Ensembl: ENSG00000170523
Vega: OTTHUMG00000169632
Pharos: P78385(Tbio)
UniProt: P78385
Position
12q13.13
AA seq 493 aa AA seqDB search
MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNS
RFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGR
LASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQE
IDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES
WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQ
QGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQ
RLCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNLVVSTGLCKPCGQLN
TTCGGGSCGQGRH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtggcttcaactccataggctgtgggttccgccctggaaacttcagctgtgtc
tctgcctgcgggccccggccaagccgctgctgcatcaccgccgccccctaccgcggcatc
tcctgctaccgcggcctcaccgggggctttggcagccacagcgtgtgcgggggcttccgc
gccggctcctgcggacgcagcttcggctaccgctccgggggcgtgtgcggacccagcccc
ccatgcatcaccaccgtgtcggtcaacgagagcctcctcacgcccctcaacctggagata
gaccccaacgcgcagtgcgtgaagcaggaggagaaggagcagatcaagtccctcaacagc
agattcgcggccttcatcgacaaggtgcgcttcctggagcagcagaacaagctgctggag
acaaagctgcagttctaccaaaaccgcgagtgctgccagagtaacctggagcccctgttt
gctggctacatcgagactctgcggcgggaggccgagtgcgtggaggctgacagtgggagg
ctggcctcagagctcaaccacgtgcaggaggtgctggagggctacaagaagaagtatgaa
gaagaagtagcacttcgagccacagcagagaacgagtttgtggctctaaagaaggatgtg
gactgcgcctacctccgcaagtcagacctggaggccaacgtggaggccctgatccaggag
attgacttcctgaggcggctgtacgaggaggagatccgcattctccaatcccacatctca
gacacctccgtggttgtcaagctggacaacagccgggacctgaacatggactgcatcgtt
gccgagatcaaggcacagtatgatgacattgccacccgtagccgggctgaggccgagtcc
tggtatcgcagcaagtgtgaggagatgaaggccacagtgatcaggcacggggagaccctg
cgccgcaccaaggaggagatcaacgagctgaaccgcatgatccagaggctgacagccgag
gtggagaatgccaagtgccagaactccaagctggaagctgcggtggcccagtctgagcag
cagggtgaggcggccctcagtgatgcccgctgcaagctggccgagctggagggcgccctg
cagaaggccaagcaagacatggcctgcctgatcagggagtaccaggaggtgatgaactcc
aagctaggcctggatatcgagatcgccacctacaggcgcctgctggagggcgaggagcag
aggctgtgtgaaggtgttgaagctgtgaatgtctgtgtcagcagctcccggggtggggtt
gtgtgcggggatctctgcgtgtcgggctcccggccggtgacgggcagcgtctgcagtgcc
ccctgcaacgggaacctggtggtgagcactggtttgtgcaagccctgtggccagctgaac
accacctgtggagggggctcctgcggccaggggaggcattaa

DBGET integrated database retrieval system