KEGG   Homo sapiens (human): 3889Help
Entry
3889              CDS       T01001                                 

Gene name
KRT83, HB3, Hb-3, KRTHB3
Definition
keratin 83
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00670  
Monilethrix
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3889 (KRT83)
  Exosomal proteins of other body fluids (saliva and urine)
   3889 (KRT83)
  Exosomal proteins of colorectal cancer cells
   3889 (KRT83)
  Exosomal proteins of bladder cancer cells
   3889 (KRT83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 493 aa AA seqDB search
MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNS
RFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGR
LASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQE
IDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES
WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQ
QGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQ
RLCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNLVVSTGLCKPCGQLN
TTCGGGSCGQGRH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtggcttcaactccataggctgtgggttccgccctggaaacttcagctgtgtc
tctgcctgcgggccccggccaagccgctgctgcatcaccgccgccccctaccgcggcatc
tcctgctaccgcggcctcaccgggggctttggcagccacagcgtgtgcgggggcttccgc
gccggctcctgcggacgcagcttcggctaccgctccgggggcgtgtgcggacccagcccc
ccatgcatcaccaccgtgtcggtcaacgagagcctcctcacgcccctcaacctggagata
gaccccaacgcgcagtgcgtgaagcaggaggagaaggagcagatcaagtccctcaacagc
agattcgcggccttcatcgacaaggtgcgcttcctggagcagcagaacaagctgctggag
acaaagctgcagttctaccaaaaccgcgagtgctgccagagtaacctggagcccctgttt
gctggctacatcgagactctgcggcgggaggccgagtgcgtggaggctgacagtgggagg
ctggcctcagagctcaaccacgtgcaggaggtgctggagggctacaagaagaagtatgaa
gaagaagtagcacttcgagccacagcagagaacgagtttgtggctctaaagaaggatgtg
gactgcgcctacctccgcaagtcagacctggaggccaacgtggaggccctgatccaggag
attgacttcctgaggcggctgtacgaggaggagatccgcattctccaatcccacatctca
gacacctccgtggttgtcaagctggacaacagccgggacctgaacatggactgcatcgtt
gccgagatcaaggcacagtatgatgacattgccacccgtagccgggctgaggccgagtcc
tggtatcgcagcaagtgtgaggagatgaaggccacagtgatcaggcacggggagaccctg
cgccgcaccaaggaggagatcaacgagctgaaccgcatgatccagaggctgacagccgag
gtggagaatgccaagtgccagaactccaagctggaagctgcggtggcccagtctgagcag
cagggtgaggcggccctcagtgatgcccgctgcaagctggccgagctggagggcgccctg
cagaaggccaagcaagacatggcctgcctgatcagggagtaccaggaggtgatgaactcc
aagctaggcctggatatcgagatcgccacctacaggcgcctgctggagggcgaggagcag
aggctgtgtgaaggtgttgaagctgtgaatgtctgtgtcagcagctcccggggtggggtt
gtgtgcggggatctctgcgtgtcgggctcccggccggtgacgggcagcgtctgcagtgcc
ccctgcaacgggaacctggtggtgagcactggtttgtgcaagccctgtggccagctgaac
accacctgtggagggggctcctgcggccaggggaggcattaa

DBGET integrated database retrieval system