KEGG   Homo sapiens (human): 3892Help
Entry
3892              CDS       T01001                                 

Gene name
KRT86, HB6, Hb1, KRTHB1, KRTHB6, MNX, hHb6
Definition
keratin 86
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00670  
Monilethrix
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3892 (KRT86)
  Exosomal proteins of other body fluids (saliva and urine)
   3892 (KRT86)
  Exosomal proteins of colorectal cancer cells
   3892 (KRT86)
  Exosomal proteins of bladder cancer cells
   3892 (KRT86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 486 aa AA seqDB search
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCG
GSCKRC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtggatcttactgtggtggccgcgccttcagctgcatctcggcctgcgggccc
cggcccggccgctgctgcatcaccgccgccccctaccgtggcatctcctgctaccgcggc
ctcaccgggggcttcggcagccacagcgtgtgcggaggctttcgggccggctcctgcgga
cgcagcttcggctaccgctccgggggcgtgtgcgggcccagtcccccatgcatcaccacc
gtgtcggtcaacgagagcctcctcacgcccctcaacctggagatcgaccccaacgcgcag
tgcgtgaagcaggaggagaaggagcagatcaagtccctcaacagcaggttcgcggccttc
atcgacaaggtgcgcttcctggagcagcagaacaaactgctggagacaaagctgcagttc
taccagaaccgcgagtgttgccagagcaacctggagcccctgtttgagggctacatcgag
actctgcggcgggaggccgagtgcgtggaggccgacagcgggaggctggcctcagagctt
aaccacgtgcaggaggtgctggagggctacaagaagaagtatgaggaggaggtttctctg
agagcaacagctgagaacgagtttgtggctctgaagaaggatgtggactgcgcctacctc
cgcaaatcagacctggaggccaatgtggaggccctgatccaggagatcgacttcctgagg
cggctgtatgaggaggagatccgcgttctccagtcccacatctcagacacctccgtggtt
gtcaagctggacaacagccgggacctgaacatggactgcatcattgccgagatcaaggca
cagtacgatgacattgtcacccgtagccgggctgaggccgagtcctggtaccgcagcaag
tgtgaggagatgaaggccacggtgatcaggcacggggagaccctgcgccgcaccaaggag
gagatcaacgagctgaaccgcatgatccagaggctgacggctgaggtggagaatgccaag
tgccagaattccaagctggaggctgcggtggctcagtctgagcagcagggtgaggcggcc
ctcagcgatgcccgctgcaagttggccgagctggagggtgccctgcagaaggccaagcag
gacatggcctgcctgatcagggagtaccaggaggtgatgaactccaagctgggcctggac
atcgagatcgccacctacaggcgcctgctggagggcgaggagcagaggctgtgcgagggc
gtcggctcggtgaatgtctgcgtcagcagctcccgcggtggcgttgtctgtggcgatctc
tgcgcctccactactgcccctgttgtctccaccagagtcagtagcgtccccagcaacagc
aacgtggtggtgggcactactaacgcctgcgccccctccgcccgggttggcgtctgcggc
ggcagctgtaagaggtgctag

DBGET integrated database retrieval system