KEGG   Homo sapiens (human): 3918Help
Entry
3918              CDS       T01001                                 

Gene name
LAMC2, B2T, BM600, CSF, EBR2, EBR2A, LAMB2T, LAMNB2
Definition
laminin, gamma 2
Orthology
K06246  
laminin, gamma 2
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00586  
Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3918 (LAMC2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3918 (LAMC2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3918 (LAMC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3918 (LAMC2)
   05222 Small cell lung cancer
    3918 (LAMC2)
  Infectious diseases
   05146 Amoebiasis
    3918 (LAMC2)
   05145 Toxoplasmosis
    3918 (LAMC2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-5 Extracellular matrix (ECM) components
      3918 (LAMC2)
   VLA-6
      3918 (LAMC2)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
      3918 (LAMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25-q31
AA seq 1193 aa AA seqDB search
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNT
DGIHCEKCKNGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGN
PEGCTQCFCYGHSASCRSSAEYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTFRLNEHPSNNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGVVPDTELEGRMQQAEQAL
QDILRDAQISEGASRSLGLQLAKVRSQENSYQSRLDDLKMTVERVRALGSQYQNRVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTR
ETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIE
ADRSYQHSLRLLDSVSRLQGVSDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRTQKNLG
NWKEEAQQLLQNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAGEALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRP
MMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgctctggctgggctgctgcctctgcttctcgctcctcctgcccgcagcccgg
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcagtgtatctttgat
cgggaacttcacagacaaactggtaatggattccgctgcctcaactgcaatgacaacact
gatggcattcactgcgagaagtgcaagaatggcttttaccggcacagagaaagggaccgc
tgtttgccctgcaattgtaactccaaaggttctcttagtgctcgatgtgacaactccgga
cggtgcagctgtaaaccaggtgtgacaggagccagatgcgaccgatgtctgccaggcttc
cacatgctcacggatgcggggtgcacccaagaccagagactgctagactccaagtgtgac
tgtgacccagctggcatcgcagggccctgtgacgcgggccgctgtgtctgcaagccagct
gtcactggagaacgctgtgataggtgtcgatcaggttactataatctggatggggggaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccgcagctctgca
gaatacagtgtccataagatcacctctacctttcatcaagatgttgatggctggaaggct
gtccaacgaaatgggtctcctgcaaagctccaatggtcacagcgccatcaagatgtgttt
agctcagcccaacgactagaccctgtctattttgtggctcctgccaaatttcttgggaat
caacaggtgagctatggtcaaagcctgtcctttgactaccgtgtggacagaggaggcaga
cacccatctgcccatgatgtgattctggaaggtgctggtctacggatcacagctcccttg
atgccacttggcaagacactgccttgtgggctcaccaagacttacacattcaggttaaat
gagcatccaagcaataattggagcccccagctgagttactttgagtatcgaaggttactg
cggaatctcacagccctccgcatccgagctacatatggagaatacagtactgggtacatt
gacaatgtgaccctgatttcagcccgccctgtctctggagccccagcaccctgggttgaa
cagtgtatatgtcctgttgggtacaaggggcaattctgccaggattgtgcttctggctac
aagagagattcagcgagactggggccttttggcacctgtattccttgtaactgtcaaggg
ggaggggcctgtgatccagacacaggagattgttattcaggggatgagaatcctgacatt
gagtgtgctgactgcccaattggtttctacaacgatccgcacgacccccgcagctgcaag
ccatgtccctgtcataacgggttcagctgctcagtgatgccggagacggaggaggtggtg
tgcaataactgccctcccggggtcaccggtgcccgctgtgagctctgtgctgatggctac
tttggggacccctttggtgaacatggcccagtgaggccttgtcagccctgtcaatgcaac
aacaatgtggaccccagtgcctctgggaattgtgaccggctgacaggcaggtgtttgaag
tgtatccacaacacagccggcatctactgcgaccagtgcaaagcaggctacttcggggac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgtaaccccatgggctca
gagcctgtaggatgtcgaagtgatggcacctgtgtttgcaagccaggatttggtggcccc
aactgtgagcatggagcattcagctgtccagcttgctataatcaagtgaagattcagatg
gatcagtttatgcagcagcttcagagaatggaggccctgatttcaaaggctcagggtggt
gatggagtagtacctgatacagagctggaaggcaggatgcagcaggctgagcaggccctt
caggacattctgagagatgcccagatttcagaaggtgctagcagatcccttggtctccag
ttggccaaggtgaggagccaagagaacagctaccagagccgcctggatgacctcaagatg
actgtggaaagagttcgggctctgggaagtcagtaccagaaccgagttcgggatactcac
aggctcatcactcagatgcagctgagcctggcagaaagtgaagcttccttgggaaacact
aacattcctgcctcagaccactacgtggggccaaatggctttaaaagtctggctcaggag
gccacaagattagcagaaagccacgttgagtcagccagtaacatggagcaactgacaagg
gaaactgaggactattccaaacaagccctctcactggtgcgcaaggccctgcatgaagga
gtcggaagcggaagcggtagcccggacggtgctgtggtgcaagggcttgtggaaaaattg
gagaaaaccaagtccctggcccagcagttgacaagggaggccactcaagcggaaattgaa
gcagataggtcttatcagcacagtctccgcctcctggattcagtgtctcggcttcaggga
gtcagtgatcagtcctttcaggtggaagaagcaaagaggatcaaacaaaaagcggattca
ctctcaagcctggtaaccaggcatatggatgagttcaagcgtacacagaagaatctggga
aactggaaagaagaagcacagcagctcttacagaatggaaaaagtgggagagagaaatca
gatcagctgctttcccgtgccaatcttgctaaaagcagagcacaagaagcactgagtatg
ggcaatgccactttttatgaagttgagagcatccttaaaaacctcagagagtttgacctg
caggtggacaacagaaaagcagaagctgaagaagccatgaagagactctcctacatcagc
cagaaggtttcagatgccagtgacaagacccagcaagcagaaagagccctggggagcgct
gctgctgatgcacagagggcaaagaatggggccggggaggccctggaaatctccagtgag
attgaacaggagattgggagtctgaacttggaagccaatgtgacagcagatggagccttg
gccatggaaaagggactggcctctctgaagagtgagatgagggaagtggaaggagagctg
gaaaggaaggagctggagtttgacacgaatatggatgcagtacagatggtgattacagaa
gcccagaaggttgataccagagccaagaacgctggggttacaatccaagacacactcaac
acattagacggcctcctgcatctgatggaccagcctctcagtgtagatgaagaggggctg
gtcttactggagcagaagctttcccgagccaagacccagatcaacagccaactgcggccc
atgatgtcagagctggaagagagggcacgtcagcagaggggccacctccatttgctggag
acaagcatagatgggattctggctgatgtgaagaacttggagaacattagggacaacctg
cccccaggctgctacaatacccaggctcttgagcaacagtga

DBGET integrated database retrieval system