KEGG   Homo sapiens (human): 3930Help
Entry
3930              CDS       T01001                                 

Gene name
LBR, DHCR14B, LMN2R, PHA, TDRD18
Definition
(RefSeq) lamin B receptor
  KO
K19532  lamin-B receptor
Organism
hsa  Homo sapiens (human)
Disease
H00234  Pelger-Huet anomaly
H00447  HEM skeletal dysplasia
H01133  Reynolds syndrome
Brite
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3930 (LBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 LBR_tudor DUF1295 ICMT PEMT
Motif
Other DBs
NCBI-GeneID: 3930
NCBI-ProteinID: NP_002287
OMIM: 600024
HGNC: 6518
Ensembl: ENSG00000143815
Vega: OTTHUMG00000037520
Pharos: Q14739(Tbio)
UniProt: Q14739
Structure
PDB: 

Jmol
Position
1q42.12
AA seq 615 aa AA seqDB search
MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSF
RQRKGGSTSSSPSRRRGSRSRSRSRSPGRPPKSARRSASASHQADIKEARREVEVKLTPL
ILKPFGNSISRYNGEPEHIERNDAPHKNTQEKFSLSQESSYIATQYSLRPRREEVKLKEI
DSKEEKYVAKELAVRTFEVTPIRAKDLEFGGVPGVFLIMFGLPVFLFLLLLMCKQKDPSL
LNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFY
AFILTSAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPAS
SGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAM
ILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPN
EVSWPMASLIIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWW
GFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWE
KYCQRVPYRIFPYIY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaggaaatttgccgatggtgaagtggtaagaggtcgatggcctgggagttca
ctttattatgaagtagaaattctgagccacgacagcacctcccagctttacactgtgaag
tataaagatggaacagagcttgaattgaaagagaatgatattaagcctttaacttccttt
aggcaaaggaaaggtggctcaacttccagttccccttccagacgccgagggagtcgatca
aggtcacgctcccgatcccctggtcgaccacctaaaagtgcccgccgatctgcttctgct
tcccaccaggccgacattaaggaagcaaggagggaagtggaagttaaattgactccgctg
attctgaagccatttggaaatagcatcagcagatataatggggagcctgagcatattgag
agaaatgacgcacctcataaaaatacacaggaaaaattcagtttgtcacaagaaagcagt
tacatagcaacacagtatagccttcgtccaagaagagaagaagtcaaattaaaagaaata
gattctaaggaagaaaaatacgttgcaaaagaactggcagtgagaacctttgaagtgacc
cccatccgggcaaaggacttggagtttggaggagtacctggtgtgtttctcatcatgttt
ggcctgcctgtgttcctcttcctgttgctgttgatgtgtaaacagaaagatcccagtctt
ctgaatttccctcctcctttgccagctttgtatgagttatgggaaaccagagtatttggg
gtctacctcctgtggtttttgattcaagtcctgttctacctactgccaattggaaaggtt
gtagaaggaacgcctcttattgatggaagaagactcaagtatagattaaatggattctat
gcttttatcctgacatctgcagtcatcggaacatctctcttccagggcgtagagtttcat
tacgtgtacagtcattttcttcagtttgcacttgcggccactgttttttgtgtggtcttg
agtgtgtatctctacatgcgctctttgaaagcgccccggaatgacctgtcgcctgccagc
tctggaaatgctgtctatgatttcttcattggccgtgaattaaaccctcgaattggtact
tttgatctcaaatacttttgtgaattgcgccccggattgattggatgggtggttattaac
ttggtgatgcttttggctgaaatgaaaatacaggaccgcgctgttccatccttggccatg
attttagttaatagtttccagcttctctatgtggtggatgctctctggaatgaggaagcg
ttgttgacgaccatggacatcatccacgatggatttggattcatgctggcttttggagac
ttggtgtgggttccctttatttacagcttccaagccttttatttagtcagtcatccaaat
gaagtgtcttggccaatggcttctctaattattgttctgaaactttgtggttatgtaatc
ttccgaggtgcaaattctcagaaaaatgcattccggaaaaatcccagtgatccaaagctt
gcacatttaaaaaccattcatacttcaacgggaaaaaatcttctagtttctggatggtgg
ggctttgttcgccaccccaattacttgggtgatctcatcatggccttggcgtggtccctc
ccatgtggttttaaccacattctgccttatttctacataatttatttcaccatgttgctt
gtccaccgagaagctcgtgacgagtaccactgtaagaagaaatacggcgtggcttgggaa
aagtactgtcagcgtgtgccctaccgtatatttccatacatctactaa

DBGET integrated database retrieval system