KEGG   Homo sapiens (human): 3930Help
Entry
3930              CDS       T01001                                 

Gene name
LBR, DHCR14B, LMN2R, PHA, TDRD18
Definition
lamin B receptor
Organism
hsa  Homo sapiens (human)
Disease
H00234  
Pelger-Huet anomaly
H00447  
HEM skeletal dysplasia
H01133  
Reynolds syndrome
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.1
AA seq 615 aa AA seqDB search
MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSF
RQRKGGSTSSSPSRRRGSRSRSRSRSPGRPPKSARRSASASHQADIKEARREVEVKLTPL
ILKPFGNSISRYNGEPEHIERNDAPHKNTQEKFSLSQESSYIATQYSLRPRREEVKLKEI
DSKEEKYVAKELAVRTFEVTPIRAKDLEFGGVPGVFLIMFGLPVFLFLLLLMCKQKDPSL
LNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFY
AFILTSAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPAS
SGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAM
ILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPN
EVSWPMASLIIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWW
GFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWE
KYCQRVPYRIFPYIY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaggaaatttgccgatggtgaagtggtaagaggtcgatggcctgggagttca
ctttattatgaagtagaaattctgagccacgacagcacctcccagctttacactgtgaag
tataaagatggaacagagcttgaattgaaagagaatgatattaagcctttaacttccttt
aggcaaaggaaaggtggctcaacttccagttccccttccagacgccgagggagtcgatca
aggtcacgctcccgatcccctggtcgaccacctaaaagtgcccgccgatctgcttctgct
tcccaccaggccgacattaaggaagcaaggagggaagtggaagttaaattgactccgctg
attctgaagccatttggaaatagcatcagcagatataatggggagcctgagcatattgag
agaaatgacgcacctcataaaaatacacaggaaaaattcagtttgtcacaagaaagcagt
tacatagcaacacagtatagccttcgtccaagaagagaagaagtcaaattaaaagaaata
gattctaaggaagaaaaatacgttgcaaaagaactggcagtgagaacctttgaagtgacc
cccatccgggcaaaggacttggagtttggaggagtacctggtgtgtttctcatcatgttt
ggcctgcctgtgttcctcttcctgttgctgttgatgtgtaaacagaaagatcccagtctt
ctgaatttccctcctcctttgccagctttgtatgagttatgggaaaccagagtatttggg
gtctacctcctgtggtttttgattcaagtcctgttctacctactgccaattggaaaggtt
gtagaaggaacgcctcttattgatggaagaagactcaagtatagattaaatggattctat
gcttttatcctgacatctgcagtcatcggaacatctctcttccagggcgtagagtttcat
tacgtgtacagtcattttcttcagtttgcacttgcggccactgttttttgtgtggtcttg
agtgtgtatctctacatgcgctctttgaaagcgccccggaatgacctgtcgcctgccagc
tctggaaatgctgtctatgatttcttcattggccgtgaattaaaccctcgaattggtact
tttgatctcaaatacttttgtgaattgcgccccggattgattggatgggtggttattaac
ttggtgatgcttttggctgaaatgaaaatacaggaccgcgctgttccatccttggccatg
attttagttaatagtttccagcttctctatgtggtggatgctctctggaatgaggaagcg
ttgttgacgaccatggacatcatccacgatggatttggattcatgctggcttttggagac
ttggtgtgggttccctttatttacagcttccaagccttttatttagtcagtcatccaaat
gaagtgtcttggccaatggcttctctaattattgttctgaaactttgtggttatgtaatc
ttccgaggtgcaaattctcagaaaaatgcattccggaaaaatcccagtgatccaaagctt
gcacatttaaaaaccattcatacttcaacgggaaaaaatcttctagtttctggatggtgg
ggctttgttcgccaccccaattacttgggtgatctcatcatggccttggcgtggtccctc
ccatgtggttttaaccacattctgccttatttctacataatttatttcaccatgttgctt
gtccaccgagaagctcgtgacgagtaccactgtaagaagaaatacggcgtggcttgggaa
aagtactgtcagcgtgtgccctaccgtatatttccatacatctactaa

DBGET integrated database retrieval system