KEGG   Homo sapiens (human): 3937Help
Entry
3937              CDS       T01001                                 

Gene name
LCP2, SLP-76, SLP76
Definition
(RefSeq) lymphocyte cytosolic protein 2
  KO
K07361  
lymphocyte cytosolic protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3937 (LCP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3937 (LCP2)
   04650 Natural killer cell mediated cytotoxicity
    3937 (LCP2)
   04660 T cell receptor signaling pathway
    3937 (LCP2)
   04664 Fc epsilon RI signaling pathway
    3937 (LCP2)
  Development
   04380 Osteoclast differentiation
    3937 (LCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.1
AA seq 533 aa AA seqDB search
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaggaatgtgccctttcgctcagaggtcctgggctgggaccccgacagcctt
gctgactatttcaagaagctcaactataaggactgtgagaaggcagtgaagaagtaccac
atcgatggggctcgcttcttgaacctgacagaaaatgacatccagaagttccccaagctc
cgggtgccgattctcagtaagttaagtcaggaaatcaacaagaacgaagagaggaggagc
atcttcacacgcaaaccccaagtcccgcggtttcctgaagagacagaaagccacgaagag
gacaatgggggctggtcgtcctttgaagaagacgattatgaaagtcccaatgatgaccag
gatggggaggatgatggagactatgagtcccccaatgaggaggaagaggcacccgtggaa
gatgacgcggattatgagccgccaccctccaatgacgaggaagctctgcagaactccatc
ctgcctgccaagcctttccccaactccaactccatgtacatcgaccggcccccctctggg
aaaaccccccagcagcctcctgtgcccccccagagaccgatggccgccctcccgccccca
ccagccggccggaatcactcgccactgcccccaccccagaccaaccacgaagaacccagc
agaagcagaaaccacaaaacggcaaagctccctgctccttcaatagacagaagcacgaaa
cctcccctagatcgttcattagctccgtttgatagagaacccttcacactaggaaagaaa
ccaccattttctgacaagccctcgattccagcgggaaggtcactcggggagcatttaccc
aagattcaaaagcctcctttaccaccgaccacggaaagacatgaaaggagcagccccctg
ccagggaagaagccacctgtgccaaagcatggatggggaccagacagaagagagaatgat
gaagatgatgtgcatcagagacctttgccccagccagcactacttcctatgagctccaac
actttcccttcaagatctactaagccaagtcccatgaaccctctcccatcctctcacatg
cctggagcattctcagaaagtaacagcagttttccacagagtgcctccctgccaccatac
ttctctcaaggccctagcaacagaccacctatcagagccgaaggcagaaacttccccttg
ccacttccaaacaaacctcggcccccatcccccgcggaggaagagaattcattaaatgaa
gagtggtacgtttcttatattacccgaccagaggcagaagctgctcttagaaagataaac
caggatggcacatttctggtcagagacagctctaaaaaaacaacaaccaatccatatgtc
ctcatggtgttgtacaaagataaagtttacaacatccagatccgttatcagaaggaaagt
caagtttacttgttgggaactggactccgagggaaagaggactttctgtctgtgtcagat
attattgactacttcaggaaaatgccacttctgctcattgatgggaaaaaccgaggttcc
agataccagtgcacattaacgcatgctgcagggtacccatag

DBGET integrated database retrieval system