KEGG   Homo sapiens (human): 3939Help
Entry
3939              CDS       T01001                                 

Gene name
LDHA, GSD11, HEL-S-133P, LDH1, LDHM
Definition
lactate dehydrogenase A (EC:1.1.1.27)
Orthology
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
HIF-1 signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 274 aa AA seqDB search
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERL
GVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESA
YEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQN
GISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctaaaggatcagctgatttataatcttctaaaggaagaacagaccccccag
aataagattacagttgttggggttggtgctgttggcatggcctgtgccatcagtatctta
atgaaggacttggcagatgaacttgctcttgttgatgtcatcgaagacaaattgaaggga
gagatgatggatctccaacatggcagccttttccttagaacaccaaagattgtctctggc
aaagtggatatcttgacctacgtggcttggaagataagtggttttcccaaaaaccgtgtt
attggaagcggttgcaatctggattcagcccgattccgttacctaatgggggaaaggctg
ggagttcacccattaagctgtcatgggtgggtccttggggaacatggagattccagtgtg
cctgtatggagtggaatgaatgttgctggtgtctctctgaagactctgcacccagattta
gggactgataaagataaggaacagtggaaagaggttcacaagcaggtggttgagagtgct
tatgaggtgatcaaactcaaaggctacacatcctgggctattggactctctgtagcagat
ttggcagagagtataatgaagaatcttaggcgggtgcacccagtttccaccatgattaag
ggtctttacggaataaaggatgatgtcttccttagtgttccttgcattttgggacagaat
ggaatctcagaccttgtgaaggtgactctgacttctgaggaagaggcccgtttgaagaag
agtgcagatacactttgggggatccaaaaggagctgcaattttaa

DBGET integrated database retrieval system