KEGG   Homo sapiens (human): 4010Help
Entry
4010              CDS       T01001                                 

Gene name
LMX1B, LMX1.2, NPS1, RP11-489N22.3
Definition
LIM homeobox transcription factor 1, beta
Orthology
K09371  
LIM homeobox transcription factor 1
Organism
hsa  Homo sapiens (human)
Disease
H00464  
Patella dysplasias
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
9q33.3
AA seq 406 aa AA seqDB search
MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQ
RPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCME
KIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVS
PDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEV
SSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQGEPGP
GQGLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGNDSIF
HDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatatagcaacaggtcccgagtcgctggagaggtgcttccctcgcgggcagacggac
tgcgccaagatgttggacggcatcaagatggaggagcacgccctgcgccccgggcccgcc
actctgggggtgctgctgggctccgactgcccgcatcccgccgtctgcgagggctgccag
cggcccatctccgaccgcttcctgatgcgagtcaacgagtcgtcctggcacgaggagtgt
ttgcagtgcgcggcgtgtcagcaagccctcaccaccagctgctacttccgggatcggaaa
ctgtactgcaaacaagactaccaacagctcttcgcggccaagtgcagcggctgcatggag
aagatcgcccccaccgagttcgtgatgcgggcgctggagtgcgtgtaccacctgggctgc
ttctgctgctgcgtgtgtgaacggcagctacgcaagggcgacgaattcgtgctcaaggag
ggccagctgctgtgcaagggtgactacgagaaggagaaggacctgctcagctccgtgagc
cccgacgagtccgactccgtgaagagcgaggatgaagatggggacatgaagccggccaag
gggcagggcagtcagagcaagggcagcggggatgacgggaaggacccgcggaggcccaag
cgaccccggaccatcctcaccacgcagcagcgaagagccttcaaggcctccttcgaggtc
tcgtcgaagccttgccgaaaggtccgagagacactggcagctgagacgggcctcagtgtg
cgcgtggtccaggtctggtttcagaaccaaagagcaaagatgaagaagctggcgcggcgg
caccagcagcagcaggagcagcagaactcccagcggctgggccagggtgagccggggccg
gggcagggcctgggccaggaggtcctgtccagccgcatggagggcatgatggcttcctac
acgccgctggccccaccacagcagcagatcgtggccatggaacagagcccctacggcagc
agcgaccccttccagcagggcctcacgccgccccaaatgccagggaacgactccatcttc
catgacatcgacagcgatacctccttaaccagcctcagcgactgcttcctcggctcctca
gacgtgggctccctgcaggcccgcgtggggaaccccatcgaccggctctactccatgcag
agttcctacttcgcctcctga

DBGET integrated database retrieval system