KEGG   Homo sapiens (human): 412Help
Entry
412               CDS       T01001                                 

Gene name
STS, ARSC, ARSC1, ASC, ES, SSDD, XLI
Definition
steroid sulfatase (microsomal), isozyme S (EC:3.1.6.2)
Orthology
K01131  
steryl-sulfatase [EC:3.1.6.2]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Disease
H00134  
X-linked ichthyosis (XLI)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    412 (STS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.2  steryl-sulfatase
     412 (STS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.32
AA seq 583 aa AA seqDB search
MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLAS
GGVKLTQHLAASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAK
LLKDQGYSTALIGKWHLGMSCHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTT
GFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPL
NCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFA
GKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGS
NGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNG
CFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQT
LPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaggaagatgaagatccctttcctcctactgttctttctgtgggaagccgag
agccacgcagcatcaaggccgaacatcatcctggtgatggctgacgacctcggcattgga
gatcctgggtgctatgggaacaaaactatcaggactcccaatatcgaccggttggccagt
gggggagtgaaactcactcagcacctggcagcatcaccgctgtgcacaccaagcagggca
gccttcatgactggccggtaccctgtccgatcaggaatggcatcttggtcccgcactgga
gttttcctcttcacagcctcttcgggaggacttcccaccgatgagattacctttgctaag
cttctgaaggatcaaggttattcaacagcactgatagggaaatggcaccttgggatgagc
tgtcacagcaagactgacttctgtcaccaccctttacatcacggcttcaattatttctat
gggatctctttgaccaatctgagagactgcaagcccggagagggcagtgtcttcaccacg
ggcttcaagaggctggtcttcctccccctgcagatcgtcggggtcaccctccttaccctt
gctgcactcaattgtctggggctactccacgtgcctctaggcgtttttttcagccttctc
ttcctagcagccctaatcctgacccttttcttgggcttccttcattacttccggcccctg
aactgcttcatgatgaggaactacgagatcattcagcagcccatgtcctatgacaatctc
acccagaggctaacggtggaggcggcccagttcatacagcggaacactgagactccgttc
ctgcttgtcttgtcctacctccacgtgcacacagccctgttctccagcaaagactttgct
ggcaaaagtcaacacggagtctacggggatgctgttgaggaaatggactggagtgtgggg
cagatcttgaaccttctggatgagctgagattggctaatgataccctcatctacttcaca
tcggaccagggagcacatgtagaagaagtgtcttccaaaggagaaattcatggcggaagt
aatgggatctataaaggaggaaaagcaaacaactgggaaggaggtatccgggttccaggc
atccttcgttggcccagggtgatacaggctggccagaagattgatgagcccactagcaac
atggacatatttcctacagtagccaagctggctggagctcccttgcctgaggacaggatc
attgatggacgtgatctgatgcccctgcttgaaggaaaaagccaacgctccgatcatgag
tttctcttccattactgcaacgcctacttaaatgctgtgcgctggcaccctcagaacagc
acatccatctggaaggcctttttcttcacccccaacttcaaccccgtgggttccaacgga
tgctttgccacacacgtgtgcttctgtttcgggagttatgtcacccatcacgacccacct
ttactctttgatatttccaaagatcccagagagagaaacccactaactccagcatccgag
ccccggttttatgaaatcctcaaagtcatgcaggaagctgcggacagacacacccagacc
ctgccagaggtgcccgatcagttttcatggaacaactttctttggaagccctggcttcag
ctgtgctgtccttccaccggcctgtcttgccagtgtgatagagaaaaacaggataagaga
ctgagccgctag

DBGET integrated database retrieval system