KEGG   Homo sapiens (human): 415Help
Entry
415               CDS       T01001                                 

Gene name
ARSE, ASE, CDPX, CDPX1, CDPXR
Definition
arylsulfatase E (chondrodysplasia punctata 1) (EC:3.1.6.1)
Orthology
K18222  
arylsulfatase E [EC:3.1.6.-]
Organism
hsa  Homo sapiens (human)
Disease
H01194  
X-linked chondrodysplasia punctata
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-  
     415 (ARSE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   415 (ARSE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3
AA seq 589 aa AA seqDB search
MLHLHHSCLCFRSWLPAMLAVLLSLAPSASSDISASRPNILLLMADDLGIGDIGCYGNNT
MRTPNIDRLAEDGVKLTQHISAASLCTPSRAAFLTGRYPVRSGMVSSIGYRVLQWTGASG
GLPTNETTFAKILKEKGYATGLIGKWHLGLNCESASDHCHHPLHHGFDHFYGMPFSLMGD
CARWELSEKRVNLEQKLNFLFQVLALVALTLVAGKLTHLIPVSWMPVIWSALSAVLLLAS
SYFVGALIVHADCFLMRNHTITEQPMCFQRTTPLILQEVASFLKRNKHGPFLLFVSFLHV
HIPLITMENFLGKSLHGLYGDNVEEMDWMVGRILDTLDVEGLSNSTLIYFTSDHGGSLEN
QLGNTQYGGWNGIYKGGKGMGGWEGGIRVPGIFRWPGVLPAGRVIGEPTSLMDVFPTVVR
LAGGEVPQDRVIDGQDLLPLLLGTAQHSDHEFLMHYCERFLHAARWHQRDRGTMWKVHFV
TPVFQPEGAGACYGRKVCPCFGEKVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMER
VQQAVWEHQRTLSPVPLQLDRLGNIWRPWLQPCCGPFPLCWCLREDDPQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgttacatctgcaccattcttgtttgtgtttcaggagctggctgccagcgatgctcgct
gtactgctaagtttggcaccatcagcttccagcgacatttccgcctcccgaccgaacatc
cttcttctgatggcggacgaccttggcattggggacattggctgctatggcaacaacacc
atgaggactccgaatattgaccgccttgcagaggacggcgtgaagctgacccaacacatc
tctgccgcatctttgtgcaccccaagcagagccgccttcctcacgggcagataccctgtg
cgatcagggatggtttccagcattggttaccgtgttcttcagtggaccggagcatctgga
ggtcttccaacaaatgagacaacttttgcaaaaatactgaaagagaaaggctatgccact
ggactcattggaaaatggcatctgggtctcaactgtgagtcagccagtgatcattgccac
caccctctccatcatggctttgaccatttctacggaatgcctttctccttgatgggtgat
tgcgcccgctgggaactctcagagaagcgtgtcaacctggaacaaaaactcaacttcctc
ttccaagtcctggccttggttgccctcacactggtagcagggaagctcacacacctgata
cccgtctcgtggatgccggtcatctggtcagccctttcggccgtcctcctcctcgcaagc
tcctattttgtgggtgctctgattgtccatgccgattgctttctgatgagaaaccacacc
atcacggagcagcccatgtgcttccaaagaacgacaccccttattctgcaggaggttgcg
tcctttctcaaaaggaataagcatgggcctttcctcctctttgtttcctttctacacgtt
cacatccctcttatcactatggagaacttcctcgggaagagtctccacgggctgtatggg
gacaacgtagaggagatggactggatggtaggacggatccttgacactttggacgtggag
ggtttgagcaacagcaccctcatttattttacgtcggatcacggcggttccctagagaat
caacttggaaacacccagtatggtggctggaatggaatttataaaggtgggaagggcatg
ggaggatgggaaggtgggatccgcgtgcccgggatcttccgctggcccggggtgctcccg
gccggccgagtgattggcgagcccacgagtctgatggacgtgttccccaccgtggtccgg
ctggcgggcggcgaggtgccccaggacagagtgattgacggccaagaccttctgcccttg
ctcctggggacagcccaacactcagaccacgagttcctgatgcattattgtgagaggttt
ctgcacgcagccaggtggcatcaacgggacagaggaacaatgtggaaagtccactttgtg
acgcctgtgttccagccagagggagccggtgcctgctatggaagaaaggtctgcccgtgc
tttggggaaaaagtagtccaccacgatccacctttgctctttgacctctcaagagaccct
tctgagacccacatcctcacaccagcctcagagcccgtgttctatcaggtgatggaacga
gtccagcaggcggtgtgggaacaccagcggacactcagcccagttcctctgcagctggac
aggctgggcaacatctggagaccgtggctgcagccctgctgtggcccgttccccctctgc
tggtgccttagggaagatgacccacaataa

DBGET integrated database retrieval system