KEGG   Homo sapiens (human): 4193Help
Entry
4193              CDS       T01001                                 

Gene name
MDM2, ACTFS, HDMX, hdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  
E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Disease
H00025  
Penile cancer
H00028  
Choriocarcinoma
H00036  
Osteosarcoma
H00037  
Alveolar rhabdomyosarcoma
H00042  
Glioma
H01513  
Retinoblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4193 (MDM2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    4193 (MDM2)
   04151 PI3K-Akt signaling pathway
    4193 (MDM2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4193 (MDM2)
  Cell growth and death
   04110 Cell cycle
    4193 (MDM2)
   04115 p53 signaling pathway
    4193 (MDM2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4193 (MDM2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4193 (MDM2)
   05202 Transcriptional misregulation in cancers
    4193 (MDM2)
   05206 MicroRNAs in cancer
    4193 (MDM2)
   05205 Proteoglycans in cancer
    4193 (MDM2)
   05203 Viral carcinogenesis
    4193 (MDM2)
   05214 Glioma
    4193 (MDM2)
   05220 Chronic myeloid leukemia
    4193 (MDM2)
   05218 Melanoma
    4193 (MDM2)
   05219 Bladder cancer
    4193 (MDM2)
   05215 Prostate cancer
    4193 (MDM2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    4193 (MDM2)
  Antineoplastic resistance
   01524 Platinum drug resistance
    4193 (MDM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4193 (MDM2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    4193 (MDM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14.3-q15
AA seq 497 aa AA seqDB search
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa
tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcaagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaagactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system