KEGG   Homo sapiens (human): 4214Help
Entry
4214              CDS       T01001                                 

Gene name
MAP3K1, MAPKKK1, MEKK, MEKK_1, MEKK1, SRXY6
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04530  Tight junction
hsa04622  RIG-I-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Disease
H00607  46,XY disorders of sex development (Disorders of gonadal development)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4214 (MAP3K1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4214 (MAP3K1)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    4214 (MAP3K1)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    4214 (MAP3K1)
  Endocrine system
   04912 GnRH signaling pathway
    4214 (MAP3K1)
  Nervous system
   04722 Neurotrophin signaling pathway
    4214 (MAP3K1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4214 (MAP3K1)
   05161 Hepatitis B
    4214 (MAP3K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4214 (MAP3K1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4214 (MAP3K1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4214 (MAP3K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 4214
NCBI-ProteinID: NP_005912
OMIM: 600982
HGNC: 6848
Ensembl: ENSG00000095015
Vega: OTTHUMG00000059486
Pharos: Q13233(Tbio)
UniProt: Q13233
Position
5q11.2
AA seq 1512 aa AA seqDB search
MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLTESVAAPDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEVQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFN
LTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANG
ESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLRA
MLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVG
REILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTD
VSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENS
SPECTVHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKG
RPHSQCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQ
TQRKFSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNS
MTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASM
PSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQD
ALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYN
LFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDST
GQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAII
EMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSR
ELLKHPVFRTTW
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccagggctacg
agccctgaggcaggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccggcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttaccgagtcggtggcggcgccggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggtccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactgtacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacgtctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtcaagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccgtacagcagcagcctttggctggatcacgaaggaatcaagagagcaattttaac
cttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagccatgg
attcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtgaga
gagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaatggg
gagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccaccagt
gggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctgtca
atggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgagagcc
atgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagacttctc
cagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagtcag
ctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcagttggc
agagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaattgt
attcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgtctt
atagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtactgat
gtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaaccttt
gctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatctac
ttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaaatg
ctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctattgca
gatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggtcaa
caggacagcttcttgcaggcatctgttcccaacaactatctggaaaccacagagaacagt
tcccctgagtgcacagtccatttagagaaaactggaaaaggattatgtgctacaaaattg
agtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttctagt
tcaacaacaacaacaacaacaacaacagagcaaccaaagccaatggttcaaacaaaaggc
agaccccacagtcagtgtttgaactcctctcctttatctcatcattcccaattaatgttt
ccagccttgtcaaccccttcttcttctaccccatctgtaccagctggcactgcaacagat
gtctctaagcatagacttcagggattcattccctgcagaataccttctgcatctcctcaa
acacagcgcaagttttctctacaattccacagaaactgtcctgaaaacaaagactcagat
aaactttccccagtctttactcagtcaagacccttgccctccagtaacatacacaggcca
aagccatctagacctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagc
atgacacttgatctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaat
agtagtaatgctgttatacccagtgacgagacagtgttcaccccagtagaggagaaatgc
agattagatgtcaatacagagctcaactccagtattgaggaccttcttgaagcatctatg
ccttcaagtgatacaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaag
gctgaaaatgatgatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaag
atggaagctgaagaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggat
gccctccccatagttcctcagctgcaggttgaaaatggagaagatatcatcattattcaa
caggatacaccagagactctaccaggacataccaaagcaaaacaaccgtatagagaagac
actgaatggctgaaaggtcaacagataggccttggagcattttcttcttgttatcaggct
caagatgtgggaactggaactttaatggctgttaaacaggtgacttatgtcagaaacaca
tcttctgagcaagaagaagtagtagaagcactaagagaagagataagaatgatgagccat
ctgaatcatccaaacatcattaggatgttgggagccacgtgtgagaagagcaattacaat
ctcttcattgaatggatggcagggggatcggtggctcatttgctgagtaaatatggagcc
ttcaaagaatcagtagttattaactacactgaacagttactccgtggcctttcgtatctc
catgaaaaccaaatcattcacagagatgtcaaaggtgccaatttgctaattgacagcact
ggtcagagactaagaattgcagattttggagctgcagccaggttggcatcaaaaggaact
ggtgcaggagagtttcagggacaattactggggacaattgcatttatggcacctgaggta
ctaagaggtcaacagtatggaaggagctgtgatgtatggagtgttggctgtgctattata
gaaatggcttgtgcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttg
atatttaagattgctagtgcaactactgctccatcgatcccttcacatttgtctcctggt
ttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctccatcaaga
gagctactgaagcatccagtctttcgtactacatggtag

DBGET integrated database retrieval system