KEGG   Homo sapiens (human): 4281Help
Entry
4281              CDS       T01001                                 

Gene name
MID1, BBBG1, FXY, GBBB1, MIDIN, OGS1, OS, OSX, RNF59, TRIM18, XPRF, ZNFXY
Definition
midline 1
Orthology
K08285  
midline 1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Disease
H00583  
Opitz-GBBB syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4281 (MID1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     4281 (MID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 667 aa AA seqDB search
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggaaacactggagtcagaactgacctgccctatttgtctggagctctttgaggaccct
cttctactgccctgcgcacacagcctctgcttcaactgcgcccaccgcatcctagtatca
cactgtgccaccaacgagtctgtggagtccatcaccgccttccagtgccccacctgccgg
catgtcatcaccctcagccagcgaggtctagacgggctcaagcgcaacgtcaccctacag
aacatcatcgacaggttccagaaagcatcagtgagcgggcccaactctcccagcgagacc
cgtcgggagcgggcctttgacgccaacaccatgacctccgccgagaaggtcctctgccag
ttttgtgaccaggatcctgcccaggacgctgtgaagacctgtgtcacttgtgaagtatcc
tactgtgacgagtgcctgaaagccactcacccgaataagaagccctttacaggccatcgt
ctgattgagccaattccggactctcacatccgggggctgatgtgcttggagcatgaggat
gagaaggtgaatatgtactgtgtgaccgatgaccagttaatctgtgccttgtgtaaactg
gttgggcggcaccgcgatcatcaggtggcagctttgagtgagcgctatgacaaattgaag
caaaacttagagagtaacctcaccaaccttattaagaggaacacagaactggagaccctt
ttggctaaactcatccaaacctgtcaacatgttgaagtcaatgcatcacgtcaagaagcc
aaattgacagaggagtgtgatcttctcattgagatcattcagcaaagacgacagattatt
ggaaccaagatcaaagaagggaaggtgatgaggcttcgcaaactggctcagcagattgca
aactgcaaacagtgcattgagcggtcagcatcactcatctcccaagcggaacactctctg
aaggagaatgatcatgcgcgtttcctacagactgctaagaatatcaccgagagagtctcc
atggcaactgcatcctcccaggttctaattcctgaaatcaacctcaatgacacatttgac
acctttgccttagatttttcccgagagaagaaactgctagaatgtctggattaccttaca
gctcccaaccctcccacaattagagaagagctctgcacagcttcatatgacaccatcact
gtgcattggacctccgatgatgagttcagcgtggtctcctacgagctccagtacaccata
ttcaccggacaagccaacgtcgttagtctgtgtaattcggctgatagctggatgatagta
cccaacatcaagcagaaccactacacggtgcacggtctgcagagcggcaccaagtacatc
ttcatggtcaaggccatcaaccaggcgggcagccgcagcagtgagcctgggaagttgaag
acaaacagccaaccatttaaactggatcccaaatctgctcatcgaaaactgaaggtgtcc
catgataacttgacagtagaacgtgatgagtcatcatccaagaagagtcacacacctgaa
cgcttcaccagccaggggagctatggagtagctggaaatgtgtttattgatagtggccgg
cattattgggaagtggtcataagtggaagcacatggtatgccattggtcttgcttacaaa
tcagccccgaagcatgaatggattgggaagaactctgcttcctgggcgctctgccgctgc
aacaataactgggtggtgagacacaatagcaaggaaatccccattgagcctgccccccac
ctccggcgcgtgggcatcctgctggactatgataacggctctatcgccttttatgatgct
ttgaactccatccacctctacaccttcgacgtcgcatttgcgcagcctgtttgccccacc
ttcaccgtgtggaacaagtgtctgacgattatcactgggctccctatcccagaccatttg
gactgcacagagcagctgccgtga

DBGET integrated database retrieval system