KEGG   Homo sapiens (human): 4481Help
Entry
4481              CDS       T01001                                 

Gene name
MSR1, CD204, SCARA1, SR-A, SRA, phSR1, phSR2
Definition
macrophage scavenger receptor 1
Orthology
K06558  
macrophage scavenger receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4481 (MSR1)
Cellular antigens [BR:hsa04090]
 Proteins
  4481 (MSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22
AA seq 358 aa AA seqDB search
MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLV
FAVLIPLIGIVAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSN
MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSL
ISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEI
KGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGPIG
PPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLRPVQLTDHIRAGPS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtgggatcactttcacaatcaacaggaggacactgatagctgctccgaatct
gtgaaatttgatgctcgctcaatgacagctttgcttcctccgaatcctaaaaacagccct
tcccttcaagagaaactgaagtccttcaaagctgcactgattgccctttacctcctcgtg
tttgcagttctcatccctctcattggaatagtggcagctcaactcctgaagtgggaaacg
aagaattgctcagttagttcaactaatgcaaatgatataactcaaagtctcacgggaaaa
ggaaatgacagcgaagaggaaatgagatttcaagaagtctttatggaacacatgagcaac
atggagaagagaatccagcatattttagacatggaagccaacctcatggacacagagcat
ttccaaaatttcagcatgacaactgatcaaagatttaatgacattcttctgcagctaagt
accttgttttcctcagtccagggacatgggaatgcaatagatgaaatctccaagtcctta
ataagtttgaataccacattgcttgatttgcagctcaacatagaaaatctgaatggcaaa
atccaagagaataccttcaaacaacaagaggaaatcagtaaattagaggagcgtgtttac
aatgtatcagcagaaattatggctatgaaagaagaacaagtgcatttggaacaggaaata
aaaggagaagtgaaagtactgaataacatcactaatgatctcagactgaaagattgggaa
cattctcagaccttgagaaatatcactttaattcaaggtcctcctggacccccgggtgaa
aaaggagatcgaggtcccactggagaaagtggtccacgaggatttccaggtccaataggt
cctccgggtcttaaaggtgatcggggagcaattggctttcctggaagtcgaggactccca
ggatatgccggaaggccaggaaattctggaccaaaaggccagaaaggggaaaaggggagt
ggaaacacattaagaccagtacaactcactgatcatattagggcagggccctcttaa

DBGET integrated database retrieval system