KEGG   Homo sapiens (human): 4613Help
Entry
4613              CDS       T01001                                 

Gene name
MYCN, MODED, N-myc, NMYC, ODED, bHLHe37
Definition
(RefSeq) MYCN proto-oncogene, bHLH transcription factor
  KO
K09109  N-myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00131  Amplified MYCN to transcriptional activation
N00132  Amplified MYCN to transcriptional repression
Disease
H00043  Neuroblastoma
H00510  Feingold syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4613 (MYCN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4613 (MYCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N HLH CENP-B_dimeris LRS4 TFIIF_alpha
Motif
Other DBs
NCBI-GeneID: 4613
NCBI-ProteinID: NP_001280157
OMIM: 164840
HGNC: 7559
Ensembl: ENSG00000134323
Vega: OTTHUMG00000039579
Pharos: P04198(Tbio)
UniProt: P04198
Structure
PDB: 

Jmol
Position
2p24.3
AA seq 464 aa AA seqDB search
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgagctgctccacgtccaccatgccgggcatgatctgcaagaacccagacctcgag
tttgactcgctacagccctgcttctacccggacgaagatgacttctacttcggcggcccc
gactcgacccccccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ctgtcgcccagccgtggcttcgcggagcacagctccgagcccccgagctgggtcacggag
atgctgcttgagaacgagctgtggggcagcccggccgaggaggacgcgttcggcctgggg
ggactgggtggcctcacccccaacccggtcatcctccaggactgcatgtggagcggcttc
tccgcccgcgagaagctggagcgcgccgtgagcgagaagctgcagcacggccgcgggccg
ccaaccgccggttccaccgcccagtccccgggagccggcgccgccagccctgcgggtcgc
gggcacggcggggctgcgggagccggccgcgccggggccgccctgcccgccgagctcgcc
cacccggccgccgagtgcgtggatcccgccgtggtcttcccctttcccgtgaacaagcgc
gagccagcgcccgtgcccgcagccccggccagtgccccggcggcgggccctgcggtcgcc
tcgggggcgggtattgccgccccagccggggccccgggggtcgcccctccgcgcccaggc
ggccgccagaccagcggcggcgaccacaaggccctcagtacctccggagaggacaccctg
agcgattcagatgatgaagatgatgaagaggaagatgaagaggaagaaatcgacgtggtc
actgtggagaagcggcgttcctcctccaacaccaaggctgtcaccacattcaccatcact
gtgcgtcccaagaacgcagccctgggtcccgggagggctcagtccagcgagctgatcctc
aaacgatgccttcccatccaccagcagcacaactatgccgccccctctccctacgtggag
agtgaggatgcacccccacagaagaagataaagagcgaggcgtccccacgtccgctcaag
agtgtcatccccccaaaggctaagagcttgagcccccgaaactctgactcggaggacagt
gagcgtcgcagaaaccacaacatcctggagcgccagcgccgcaacgaccttcggtccagc
tttctcacgctcagggaccacgtgccggagttggtaaagaatgagaaggccgccaaggtg
gtcattttgaaaaaggccactgagtatgtccactccctccaggccgaggagcaccagctt
ttgctggaaaaggaaaaattgcaggcaagacagcagcagttgctaaagaaaattgaacac
gctcggacttgctag

DBGET integrated database retrieval system