KEGG   Homo sapiens (human): 4613Help
Entry
4613              CDS       T01001                                 

Gene name
MYCN, MODED, MYCNOT, N-myc, NMYC, ODED, bHLHe37
Definition
v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
Orthology
K09109  
N-myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00043  
Neuroblastoma
H00510  
Feingold syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4613 (MYCN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4613 (MYCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p24.3
AA seq 464 aa AA seqDB search
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgagctgctccacgtccaccatgccgggcatgatctgcaagaacccagacctcgag
tttgactcgctacagccctgcttctacccggacgaagatgacttctacttcggcggcccc
gactcgacccccccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ctgtcgcccagccgtggcttcgcggagcacagctccgagcccccgagctgggtcacggag
atgctgcttgagaacgagctgtggggcagcccggccgaggaggacgcgttcggcctgggg
ggactgggtggcctcacccccaacccggtcatcctccaggactgcatgtggagcggcttc
tccgcccgcgagaagctggagcgcgccgtgagcgagaagctgcagcacggccgcgggccg
ccaaccgccggttccaccgcccagtccccgggagccggcgccgccagccctgcgggtcgc
gggcacggcggggctgcgggagccggccgcgccggggccgccctgcccgccgagctcgcc
cacccggccgccgagtgcgtggatcccgccgtggtcttcccctttcccgtgaacaagcgc
gagccagcgcccgtgcccgcagccccggccagtgccccggcggcgggccctgcggtcgcc
tcgggggcgggtattgccgccccagccggggccccgggggtcgcccctccgcgcccaggc
ggccgccagaccagcggcggcgaccacaaggccctcagtacctccggagaggacaccctg
agcgattcagatgatgaagatgatgaagaggaagatgaagaggaagaaatcgacgtggtc
actgtggagaagcggcgttcctcctccaacaccaaggctgtcaccacattcaccatcact
gtgcgtcccaagaacgcagccctgggtcccgggagggctcagtccagcgagctgatcctc
aaacgatgccttcccatccaccagcagcacaactatgccgccccctctccctacgtggag
agtgaggatgcacccccacagaagaagataaagagcgaggcgtccccacgtccgctcaag
agtgtcatccccccaaaggctaagagcttgagcccccgaaactctgactcggaggacagt
gagcgtcgcagaaaccacaacatcctggagcgccagcgccgcaacgaccttcggtccagc
tttctcacgctcagggaccacgtgccggagttggtaaagaatgagaaggccgccaaggtg
gtcattttgaaaaaggccactgagtatgtccactccctccaggccgaggagcaccagctt
ttgctggaaaaggaaaaattgcaggcaagacagcagcagttgctaaagaaaattgaacac
gctcggacttgctag

DBGET integrated database retrieval system