KEGG   Homo sapiens (human): 4624Help
Entry
4624              CDS       T01001                                 

Gene name
MYH6, ASD3, CMD1EE, CMH14, MYHC, MYHCA, SSS3, alpha-MHC
Definition
myosin, heavy chain 6, cardiac muscle, alpha
Orthology
K17751  
myosin heavy chain 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Tight junction
Thyroid hormone signaling pathway
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
H00546  
Atrial septal defect
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    4624 (MYH6)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4624 (MYH6)
  Circulatory system
   04260 Cardiac muscle contraction
    4624 (MYH6)
   04261 Adrenergic signaling in cardiomyocytes
    4624 (MYH6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4624 (MYH6)
   05414 Dilated cardiomyopathy (DCM)
    4624 (MYH6)
   05416 Viral myocarditis
    4624 (MYH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q12
AA seq 1939 aa AA seqDB search
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVI
AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD
PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKL
MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN
SLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKM
EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN
NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK
KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGAKQKMHDEE
NT seq 5820 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgcccagatggctgactttggggcagcggcccagtacctccgcaagtcagag
aaggagcgtctagaggcccagacccggccctttgacattcgcactgagtgcttcgtgccc
gatgacaaggaagagtttgtcaaagccaagattttgtcccgggagggaggcaaggtcatt
gctgaaaccgagaatgggaagacggtgactgtgaaggaggaccaggtgttgcagcagaac
ccacccaagttcgacaagattgaggacatggccatgctgaccttcctgcacgagcccgcg
gtgcttttcaacctcaaggagcgctacgcggcctggatgatatatacctactcgggcctc
ttctgtgtcactgtcaacccctacaagtggctgccggtgtacaatgccgaggtggtggcc
gcctaccggggcaagaagaggagtgaggccccgccccacatcttctccatctccgacaac
gcctatcagtacatgctgacagatcgggagaaccagtccatcctcatcacgggagaatcc
ggggcggggaagactgtgaacaccaagcgtgtcatccagtactttgccagcattgcagcc
ataggtgaccgtggcaagaaggacaatgccaatgcgaacaagggcaccctggaggaccag
atcatccaggccaaccccgctctggaggccttcggcaatgccaagactgtccggaacgac
aactcctcccgctttgggaaattcattaggatccactttggggccactggaaagctggct
tctgcagacatagagacctacctgctggagaagtcccgggtgatcttccagctgaaagct
gagagaaactaccacatcttctaccagattctgtccaacaagaagccggagttgctggac
atgctgctggtcaccaacaatccctacgactacgccttcgtgtctcagggagaggtgtcc
gtggcctccattgatgactccgaggagctcatggccaccgatagtgcctttgacgtgctg
ggcttcacttcagaggagaaagctggcgtctacaagctgacgggagccatcatgcactac
gggaacatgaagttcaagcagaagcagcgggaggagcaggcggagccagacggcaccgaa
gatgctgacaagtcggcctacctcatggggctgaactcagctgacctgctcaaggggctg
tgccaccctcgggtgaaagtgggcaacgagtatgtcaccaaggggcagagcgtgcagcag
gtgtactactccatcggggctctggccaaggcagtgtatgagaagatgttcaactggatg
gtgacgcgcatcaacgccaccctggagaccaagcagccacgccagtacttcataggagtc
ctggacatcgctggcttcgagatcttcgacttcaacagctttgagcagctctgcatcaac
ttcaccaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggagggcattgagtggacattcattgactttggcatggacctgcaggcc
tgcattgacctcatcgagaagcccatgggcatcatgtccatcctggaggaggagtgcatg
ttccccaaggccactgacatgaccttcaaggccaagctgtacgacaaccacctgggcaag
tccaacaatttccagaagccacgcaacatcaaggggaagcaggaagcccacttctccctg
atccactacgccggcactgtggactacaacatcctgggctggctggaaaaaaacaaggat
cctctcaacgagactgttgtggccctgtaccagaagtcctccctcaagctcatggccact
ctcttctcctcctacgcaactgccgatactggggacagtggtaaaagcaaaggaggcaag
aaaaagggctcatccttccagacggtgtcggctctccaccgggaaaatctcaacaagcta
atgaccaacctgaggaccacccatcctcactttgtgcgttgcatcatccccaatgagcgg
aaggctccaggggtgatggacaaccccctggtcatgcaccagctgcgctgcaatggcgtg
ctggagggcatccgcatctgcaggaagggcttccccaaccgcatcctctacggggacttc
cggcagaggtatcgcatcctgaacccagtggccatccctgagggacagttcattgatagc
aggaaggggacagagaagctgctcagctctctggacattgatcacaaccagtacaagttt
ggccacaccaaggtgttcttcaaggcagggctgcttgggctgctggaggagatgcgggat
gagaggctgagccgcatcatcacgcgcatgcaggcccaagcccggggccagctcatgcgc
attgagttcaagaagatagtggaacgcagggatgccctgctggtaatccagtggaacatt
cgggccttcatgggggtcaagaattggccctggatgaagctctacttcaagatcaagccg
ctgctgaagagcgcagagacggagaaggagatggccaccatgaaggaagagttcgggcgc
atcaaagagacgctggagaagtccgaggctcgccgcaaggagctggaggagaagatggtg
tccctgctgcaggagaagaatgacctgcagctccaagtgcaggcggaacaagacaacctc
aatgatgctgaggagcgctgcgaccagctgatcaaaaacaagattcagctggaggccaaa
gtaaaggagatgaatgagaggctggaggatgaggaggagatgaacgcggagctcactgcc
aagaagcgcaagctggaagacgagtgctcagagctcaagaaggacattgatgacctggag
ctgacactggccaaggtggagaaggagaagcatgcaacagagaacaaggtgaagaaccta
acagaggagatggctgggctggatgaaatcatcgctaagctgaccaaggagaagaaagct
ctacaagaggcccatcagcaggccctggatgaccttcaggttgaggaagacaaggtcaac
agcctgtccaagtctaaggtcaagctggagcagcaggtggatgatctggagggatcccta
gagcaagagaagaaggtgcgcatggacctggagcgagcaaagcggaaactggagggcgac
ctgaagctgacccaggagagcatcatggacctggaaaatgataaactgcagctggaagaa
aagcttaagaagaaggagtttgacattaatcagcagaacagtaagattgaggatgagcag
gtgctggcccttcaactacagaagaaactgaaggaaaaccaggcacgcatcgaggagctg
gaggaggagctggaggccgagcgcaccgccagggctaaggtggagaagctgcgctcagac
ctgtctcgggagctggaggagatcagcgagcggctggaagaggccggcggggccacgtcc
gtgcagatcgagatgaacaagaagcgcgaggccgagttccagaagatgcggcgggacctg
gaggaggccacgctgcagcacgaggccactgccgcggccctgcgcaagaagcacgccgac
agcgtggccgagctgggcgagcagatcgacaacctgcagcgggtgaagcagaagctggag
aaggagaagagcgagttcaagctggagctggatgacgtcacctccaacatggagcagatc
atcaaggccaaggcaaacctggagaaagtgtctcggacgctggaggaccaggccaatgag
taccgcgtgaagctagaagaggcccaacgctccctcaatgatttcaccacccagcgagcc
aagctgcagaccgagaatggagagttggcccggcagctagaggaaaaggaggcgctaatc
tcgcagctgacccgggggaagctctcttatacccagcaaatggaggacctcaaaaggcag
ctggaggaggagggcaaggcgaagaacgccctggcccatgcactgcagtcggcccggcat
gactgcgacctgctgcgggagcagtacgaggaggagacagaggccaaggccgagctgcag
cgcgtcctgtccaaggccaactcggaggtggcccagtggaggaccaagtatgagacggac
gccattcagcggactgaggagctcgaagaggccaaaaagaagctggcccagcggctgcag
gatgccgaggaggccgtggaggctgttaatgccaagtgctcctcactggagaagaccaag
caccggctacagaatgagatagaggacttgatggtggacgtagagcgctccaatgctgct
gctgcagccctggacaagaagcagagaaactttgacaagatcctggccgagtggaagcag
aagtatgaggagtcgcagtctgagctggagtcctcacagaaggaggctcgctccctcagc
acagagctcttcaagctcaagaacgcctacgaggagtccctggagcacctagagaccttc
aagcgggagaacaagaaccttcaggaggaaatctcggaccttactgagcagctaggagaa
ggaggaaagaatgtgcatgagctggagaaggtccgcaaacagctggaggtggagaagctg
gagctgcagtcagccctggaggaggcagaggcctccctggagcacgaggagggcaagatc
ctccgggcccagctagagttcaaccagatcaaggcagagatcgagcggaagctggcagag
aaggacgaggagatggaacaggccaagcgcaaccaccagcgggtggtggactcgctgcag
acctccctggatgcagagacacgcagccgcaacgaggtcctgagggtgaagaagaagatg
gaaggagacctcaatgagatggagatccagctcagccacgccaaccgcatggctgccgag
gcccagaagcaagtcaagagcctccagagcttgctgaaggacacccagatccagctggac
gatgcggtccgtgccaacgacgacctgaaggagaacatcgccatcgtggagcggcgcaac
aacctgctgcaggctgagctggaggagctgcgtgccgtggtggagcagacagagcggtcc
cggaagctggcggagcaggagctgattgagaccagcgagcgggtgcagctgctgcattcc
cagaacaccagcctcatcaaccagaagaagaagatggagtcggatctgacccagctccag
tcggaagtggaggaggcagtgcaggagtgcagaaacgccgaggagaaggccaagaaggcc
atcacggatgccgccatgatggcagaggagctgaagaaggagcaggacaccagcgcccac
ctggagcgcatgaagaagaacatggagcagaccattaaggacctgcagcaccggctggac
gaggccgagcagatcgccctcaagggaggcaagaagcagctgcagaagctggaagcgcgg
gtgcgggagctggagggtgagctggaggccgagcagaagcgcaacgcagagtcggtgaag
ggcatgaggaagagcgagcggcgcatcaaggagctcacctaccagacagaggaagacaaa
aagaacctgctgcggctacaggacctggtggacaagctgcaactgaaggtcaaggcctac
aagcgccaggccgaggaggcggaggagcaagccaacaccaacctgtccaagttccgcaag
gtgcagcatgagctggatgaggcagaggagcgggcggacatcgctgagtcccaggtcaac
aagcttcgagccaagagccgtgacattggtgccaagcaaaaaatgcacgatgaggagtga

DBGET integrated database retrieval system