KEGG   Homo sapiens (human): 4644Help
Entry
4644              CDS       T01001                                 

Gene name
MYO5A, GS1, MYH12, MYO5, MYR12
Definition
myosin VA (heavy chain 12, myoxin)
Orthology
K10357  
myosin V
Organism
hsa  Homo sapiens (human)
Disease
H00101  
Other phagocyte defects
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21
AA seq 1855 aa AA seqDB search
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELP
HLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVD
DAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVN
QALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAIS
PTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRC
IKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVL
SDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGW
LLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAA
TIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMM
AKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSE
TEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQET
EQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQN
LLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRT
EEPSEKKVPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLRSKAKEEERPQIRGAE
LEYESLKRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELD
VRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETNR
SSALDYHELNEDGELWLVYEGLKQANRLLESQLQSQKRSHENEAEALRGEIQSLKEENNR
QQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKI
GELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGV
AVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSN
TCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENI
LQPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGM
DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA
KETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSF
IRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV
NT seq 5568 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcggagctctacacaaagtttgccagggtttggatacctgatccagaggaa
gtctggaagtcagcagagctgctcaaagattataagccaggagataaagtcctcctgctt
cacctcgaggaaggaaaggatttggaataccatctagatccaaagaccaaggagctgcct
cacttacgaaatcctgacatacttgttggtgaaaatgacctcacagccctcagctatctt
catgagcctgctgtgctccataatctcagagtccgctttattgattccaaacttatttat
acgtattgtggtatagtcctagtagctataaatccctatgaacagctgcctatttatgga
gaagatattattaatgcatacagtggtcagaacatgggtgatatggatccacatatcttt
gcagtagctgaagaagcttacaagcaaatggccagagatgaacgaaatcagtccatcatc
gtaagtggagagtctggggcaggaaaaacagtctcagctaagtatgccatgcgatacttt
gcaactgtgagtggttctgccagtgaggccaatgtggaggaaaaggtcttggcctccaac
cccatcatggagtccattggaaatgctaaaacaaccaggaatgataatagcagccgtttt
gggaagtatattgagattggttttgataagagatatcgaatcattggtgccaatatgaga
acttatcttttagagaaatccagagtggtattccaggcagaagaggagagaaactatcat
atcttctatcagctttgtgcctcagcaaagttacctgaatttaaaatgctacgattagga
aatgcagataactttaattacacaaaacaaggaggcagtcctgtgattgaaggagtggat
gatgcaaaggagatggcacatactaggcaggcctgcactttgctaggaattagtgaatct
catcaaatgggaattttccgaatacttgctggcatccttcacttaggcaatgttggattt
acatcccgagatgcagacagctgcacaatacctcccaagcatgaacctctctgcatcttc
tgtgacctcatgggtgtggactatgaggagatgtgtcactggctctgccatcggaaactg
gctactgccacagagacatacatcaagcccatctccaagctgcaggccacgaatgcccgc
gatgctttggccaagcacatctatgccaagctctttaactggattgtagataatgtcaat
caggctctccattctgctgtcaaacagcactcttttattggtgtgctagacatttacgga
tttgaaacatttgagataaatagttttgaacagttttgcataaattatgcaaatgaaaaa
ctacagcaacaattcaatatgcatgtcttcaaattggagcaagaagaatatatgaaggaa
caaattccatggacactcatagatttttatgataatcagccttgtattaatcttatagaa
tcaaaactaggcattctagatttactggatgaggaatgcaagatgcctaaaggcacagat
gacacctgggcccaaaaattgtacaacacacatttgaacaaatgtgcactctttgaaaag
cctcgtctatcaaacaaagctttcatcatccaacattttgctgacaaagtggaataccag
tgtgaaggatttctcgaaaagaataaagacaccgtttttgaagaacaaattaaagttctt
aaatcaagcaagtttaagatgctaccagaactatttcaagatgatgagaaggccatcagt
ccaacttcagccacctcctcagggcgcacacccctcacacgaactcctgcaaagcccacc
aaaggcagaccaggccaaatggccaaagagcacaagaaaacagtggggcatcagttcaga
aactccctgcacctgcttatggagacactcaatgccactacccctcactatgtgcgctgt
atcaagcctaatgacttcaagttcccattcacgtttgatgagaagagggcagtgcagcag
ctgagagcatgtggtgtcctggaaaccatccgaatcagtgcggccggtttcccctcacgg
tggacttaccaagaatttttcagccgctaccgtgtcctaatgaagcagaaagatgtgctg
agtgacagaaagcaaacatgcaagaatgtgttagagaaactgatactggacaaggacaaa
taccagtttggtaagacaaagatctttttccgtgccggtcaagtggcctatctagaaaaa
ttgagagctgacaaactgagagctgcctgcatccggatccagaagaccatccgagggtgg
ctgctgagaaagaagtacctacgcatgcggaaggcagccatcaccatgcagagatacgtg
cggggctaccaggcccgatgctatgctaagtttctgcgcagaaccaaggcagcaaccatc
attcaaaagtactggcgcatgtatgtggtccgcaggaggtacaagattagacgagctgcc
actattgttcttcagtcttacttgcgaggcttcttggccagaaataggtatcgcaagata
ctccgtgagcacaaagcagtcatcattcagaagcgagtccggggctggctggcccgcaca
cactacaagaggagcatgcatgccatcatctaccttcagtgctgcttcaggcggatgatg
gccaagcgtgagctaaagaagctcaaaatcgaggctcgctcagtggagcgctataagaag
ctgcacatcggcatggagaacaagatcatgcagctgcagcgcaaagttgatgagcagaac
aaagactacaaatgccttgtggagaaactaaccaatctggaaggaatatacaactctgag
actgagaaactacgaagtgacttagaacgtcttcaactaagtgaagaggaagcgaaagtt
gccactgggcgggtccttagtctgcaggaagaaattgccaagctccggaaagacctggag
caaactcgttcagagaaaaaatgcattgaggaacatgcagatcgatacaaacaagaaaca
gagcagctggtatcaaatctgaaggaagaaaatactttgctgaagcaagaaaaagaagcc
ctcaatcaccgcatcgtgcagcaggctaaggagatgacagaaactatggagaagaagtta
gtagaagaaacgaaacaactggaactcgaccttaatgatgaaaggctgagatatcagaac
cttctgaatgagttcagtcgcctggaagaaagatatgatgacctcaaggaagagatgacc
cttatggtgcatgtgcctaagcctggacacaagagaacagactccacccacagcagcaac
gagtctgaatatatctttagctctgaaattgcagaaatggaagacattccatcaaggaca
gaggaaccaagtgagaagaaggtacctctggacatgtcattgttccttaagctccagaag
cgggtcacagagctggagcaggagaagcaggtgatgcaggatgagctggaccgcaaggag
gagcaggtgctccgcagcaaggccaaggaagaagaaagaccacaaattagaggtgcagaa
ctggaatatgagtcactcaagcgtcaagaactagaatcagaaaacaaaaaactgaagaat
gagctaaatgagttgcgcaaggccctcagtgagaaaagtgccccagaggtgaccgcccca
ggtgcacctgcctaccgtgtcctcatggagcagctgacctctgtgagcgaggagcttgat
gtccgcaaggaggaagtcctcatcttaaggtctcaactggtgagccagaaagaggccatc
caacccaaggatgacaagaatacaatgacagattccacaatacttttggaagatgtacaa
aaaatgaaagataaaggtgaaatagcacaagcatacattggtttgaaagaaacaaataga
tcatctgctctggattaccatgagttgaatgaggatggagagctgtggctggtttatgaa
gggttaaaacaagccaacaggctcctggaatcccagctgcagtcacagaagaggagccat
gagaatgaggccgaggccctccgtggggagatccagagcctgaaggaggagaacaaccga
cagcagcagctgctggcccagaacctgcagctgcccccagaggcccgcattgaggccagc
ctgcagcacgagatcacccggctgaccaacgaaaacttggatttgatggaacaacttgaa
aaacaggataagacggtccgtaaactgaaaaaacaactgaaagtatttgccaaaaaaatt
ggcgaactagaagtgggccagatggagaacatatccccaggacagatcattgatgaaccc
atccgaccagtcaacattcccaggaaagaaaaggatttccaagggatgctggaatacaag
aaggaggatgagcaaaaacttgttaagaacctgattctggaactgaagccacgtggtgta
gcagtcaatttgattccaggattaccggcatatatcctgttcatgtgtgttcgacatgct
gactacctgaatgatgatcagaaagtaaggtcgttgctaacatcaacaattaacagcatc
aaaaaagtattgaagaaaagaggtgatgattttgaaaccgtctccttctggctctctaac
acatgccgatttttgcactgcttgaaacagtacagtggagaagagggctttatgaagcac
aacacatctcgccagaatgaacactgcctcaccaattttgacctggctgagtatcggcag
gtgctgagtgacttggccattcagatctaccagcagctcgtgcgggtgttagagaacatc
cttcagccaatgattgtctcaggcatgctggaacatgaaacgattcagggcgtgtctggg
gtgaagcccacagggttgagaaagcgaacctccagtatcgccgatgagggcacctacaca
ctggactccatcctccggcagctcaactccttccactcggtcatgtgtcagcatggcatg
gaccctgaactgatcaagcaggtggtcaagcagatgttctacatcataggggccatcacc
ctgaacaaccttctcctgcggaaggacatgtgctcctggagtaaaggcatgcagatcagg
tacaatgtcagtcaactggaagaatggctgcgtgacaagaatctgatgaatagtggggct
aaagaaaccctggaacctctcattcaggctgctcaacttttgcaagtgaaaaagaaaaca
gatgatgatgcagaagccatttgttctatgtgcaatgctttaactactgcccagattgtg
aaagtgttgaatttgtatactccagttaatgagtttgaagaaagagtctctgtgtcgttc
attcgtactatacagatgcgtttacgagacaggaaagactctccccagctgctcatggat
gctaaacacatctttcctgtcacctttcctttcaacccatcttccctcgcactagaaacc
atccagattccagccagcctcggcctgggcttcatttcacgggtctga

DBGET integrated database retrieval system