KEGG   Homo sapiens (human): 4689Help
Entry
4689              CDS       T01001                                 

Gene name
NCF4, NCF, P40PHOX, SH3PXD4
Definition
neutrophil cytosolic factor 4, 40kDa
Orthology
K08012  
neutrophil cytosolic factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Leishmaniasis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 339 aa AA seqDB search
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcccagcagctgcgggccgagagtgactttgaacagcttccggatgatgtt
gccatctcggccaacattgctgacatcgaggagaagagaggcttcaccagccactttgtt
ttcgtcatcgaggtgaagacaaaaggaggatccaagtacctcatctaccgccgctaccgc
cagttccatgctttgcagagcaagctggaggagcgcttcgggccagacagcaagagcagt
gccctggcctgtaccctgcccacactcccagccaaagtctacgtgggtgtgaaacaggag
atcgccgagatgcggatacctgccctcaacgcctacatgaagagcctgctcagcctgccg
gtctgggtgctgatggatgaggacgtccggatcttcttttaccagtcgccctatgactca
gagcaggtgccccaggcactccgccggctccgcccgcgcacccggaaagtcaagagcgtg
tccccacagggcaacagcgttgaccgcatggcagctccgagagcagaggctctatttgac
ttcactggaaacagcaaactggagctgaatttcaaagctggagatgtgatcttcctcctc
agtcggatcaacaaagactggctggagggcactgtccggggagccacgggcatcttccct
ctctccttcgtgaagatcctcaaagacttccctgaggaggacgaccccaccaactggctg
cgttgctactactacgaagacaccatcagcaccatcaaggacatcgcggtggaggaagat
ctcagcagcactcccctattgaaagacctgctggagctcacaaggcgggagttccagaga
gaggacatagctctgaattaccgggacgctgagggggatctggttcggctgctgtcggat
gaggacgtagcgctcatggtgcggcaggctcgtggcctcccctcccagaagcgcctcttc
ccctggaagctgcacatcacgcagaaggacaactacagggtctacaacacgatgccatga

DBGET integrated database retrieval system