KEGG   Homo sapiens (human): 4744Help
Entry
4744              CDS       T01001                                 

Gene name
NEFH, NFH
Definition
neurofilament, heavy polypeptide
Orthology
K04574  
neurofilament heavy polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    4744 (NEFH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 1020 aa AA seqDB search
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSA
SPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEA
HNRSLEGEAAALRQQQAGRSAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAH
VRQRLDDEARQREEAEAAARALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGE
LLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRL
SEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASY
QEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPF
SLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKE
EEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKS
PAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKS
PEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEKAKSPEKEEA
KSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPE
KAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEARSPADK
FPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVKVKEPPK
KAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKKEEAEDK
KKVPTPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEKKDTKEE
KAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATEDKAAKGK
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcttcggcggcgcggacgcgctgctgggcgccccgttcgcgccgctgcatggc
ggcggcagcctccactacgcgctagcccgaaagggtggcgcaggcgggacgcgctccgcc
gctggctcctccagcggcttccactcgtggacacggacgtccgtgagctccgtgtccgcc
tcgcccagccgcttccgtggcgcaggcgccgcctcaagcaccgactcgctggacacgctg
agcaacgggccggagggctgcatggtggcggtggccacctcacgcagtgagaaggagcag
ctgcaggcgctgaacgaccgcttcgccgggtacatcgacaaggtgcggcagctggaggcg
cacaaccgcagcctggagggcgaggctgcggcgctgcggcagcagcaggcgggccgctcc
gctatgggcgagctgtacgagcgcgaggtccgcgagatgcgcggcgcggtgctgcgcctg
ggcgcggcgcgcggtcagctacgcctggagcaggagcacctgctcgaggacatcgcgcac
gtgcgccagcgcctagacgacgaggcccggcagcgagaggaggccgaggcggcggcccgc
gcgctggcgcgcttcgcgcaggaggccgaggcggcgcgcgtggacctgcagaagaaggcg
caggcgctgcaggaggagtgcggctacctgcggcgccaccaccaggaagaggtgggcgag
ctgctcggccagatccagggctccggcgccgcgcaggcgcagatgcaggccgagacgcgc
gacgccctgaagtgcgacgtgacgtcggcgctgcgcgagattcgcgcgcagcttgaaggc
cacgcggtgcagagcacgctgcagtccgaggagtggttccgagtgaggctggaccgactg
tcggaggcagccaaggtgaacacagacgctatgcgctcagcgcaggaggagataactgag
taccggcgtcagctgcaggccaggaccacagagctggaggcactgaaaagcaccaaggac
tcactggagaggcagcgctctgagctggaggaccgtcatcaggccgacattgcctcctac
caggaagccattcagcagctggacgctgagctgaggaacaccaagtgggagatggccgcc
cagctgcgagaataccaggacctgctcaatgtcaagatggctctggatatagagatagcc
gcttacagaaaactcctggaaggtgaagagtgtcggattggctttggcccaattcctttc
tcgcttccagaaggactccccaaaattccctctgtgtccactcacataaaggtgaaaagc
gaagagaagatcaaagtggtggagaagtctgagaaagaaactgtgattgtggaggaacag
acagaggagacccaagtgactgaagaagtgactgaagaagaggagaaagaggccaaagag
gaggagggcaaggaggaagaagggggtgaagaagaggaggcagaagggggagaagaagaa
acaaagtctcccccagcagaagaggctgcatccccagagaaggaagccaagtcaccagta
aaggaagaggcaaagtcaccggctgaggccaagtccccagagaaggaggaagcaaaatcc
ccagccgaagtcaagtcccctgagaaggccaagtctccagcaaaggaagaggcaaagtca
ccgcctgaggccaagtccccagagaaggaggaagcaaaatctccagctgaggtcaagtcc
cccgagaaggccaagtccccagcaaaggaagaggcaaagtcaccggctgaggccaagtct
ccagagaaggccaagtccccagtgaaggaagaagcaaagtcaccggctgaggccaagtcc
ccagtgaaggaagaagcaaaatctccagctgaggtcaagtccccggaaaaggccaagtct
ccaacgaaggaggaagcaaagtcccctgagaaggccaagtccccagagaaggaagaggcc
aagtcccctgagaaggccaagtccccagtgaaggcagaagcaaagtcccctgagaaggcc
aagtccccagtgaaggcagaagcaaagtcccctgagaaggccaagtccccagtgaaggaa
gaagcaaagtcccctgagaaggccaagtccccagtgaaggaagaagcaaagtcccctgag
aaggccaagtccccagtgaaggaagaagcaaagacccccgagaaggccaagtccccagtg
aaggaagaagctaagtccccagagaaggccaagtccccagagaaggccaagactcttgat
gtgaagtctccagaagccaagactccagcgaaggaggaagcaaggtcccctgcagacaaa
ttccctgaaaaggccaaaagccctgtcaaggaggaggtcaagtccccagagaaggcgaaa
tctcccctgaaggaggatgccaaggcccctgagaaggagatcccaaaaaaggaagaggtg
aagtccccagtgaaggaggaggagaagccccaggaggtgaaagtcaaagagcccccaaag
aaggcagaggaagagaaagcccctgccacaccaaaaacagaggagaagaaggacagcaag
aaagaggaggcacccaagaaggaggctccaaagcccaaggtggaggagaagaaggaacct
gctgtcgaaaagcccaaagaatccaaagttgaagccaagaaggaagaggctgaagataag
aaaaaagtccccaccccagagaaggaggctcctgccaaggtggaggtgaaggaagacgct
aaacccaaagaaaagacagaggtagccaagaaggaaccagatgatgccaaggccaaggaa
cccagcaaaccagcagagaagaaggaggcagcaccggagaaaaaagacaccaaggaggag
aaggccaagaagcctgaggagaaacccaagacagaggccaaagccaaggaagatgacaag
accctctcaaaagagcctagcaagcctaaggcagaaaaggctgaaaaatcctccagcaca
gaccaaaaagacagcaagcctccagagaaggccacagaagacaaggccgccaaggggaag
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system