KEGG   Homo sapiens (human): 4860Help
Entry
4860              CDS       T01001                                 

Gene name
PNP, NP, PRO1837, PUNP
Definition
(RefSeq) purine nucleoside phosphorylase
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00093  Combined immunodeficiencies (CIDs)
Drug target
Forodesine (DG01392): D04245 D06596
Ulodesine (DG01881): D10431 D10432
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4860 (PNP)
   00240 Pyrimidine metabolism
    4860 (PNP)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4860 (PNP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     4860 (PNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 4860
NCBI-ProteinID: NP_000261
OMIM: 164050
HGNC: 7892
Ensembl: ENSG00000198805
Vega: OTTHUMG00000029546
Pharos: P00491(Tchem)
UniProt: P00491 V9HWH6
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 289 aa AA seqDB search
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggatacacctatgaagattataagaacactgcagaatggcttctgtctcac
actaagcaccgacctcaagttgcaataatctgtggttctggattaggaggtctgactgat
aaattaactcaggcccagatctttgactacggtgaaatccccaactttccccgaagtaca
gtgccaggtcatgctggccgactggtgtttgggttcctgaatggcagggcctgtgtgatg
atgcagggcaggttccacatgtatgaagggtacccactctggaaggtgacattcccagtg
agggttttccaccttctgggtgtggacaccctggtagtcaccaatgcagcaggagggctg
aaccccaagtttgaggttggagatatcatgctgatccgtgaccatatcaacctacctggt
ttcagtggtcagaaccctctcagagggcccaatgatgaaaggtttggagatcgtttccct
gccatgtctgatgcctacgaccggactatgaggcagagggctctcagtacctggaaacaa
atgggggagcaacgtgagctacaggaaggcacctatgtgatggtggcaggccccagcttt
gagactgtggcagaatgtcgtgtgctgcagaagctgggagcagacgctgttggcatgagt
acagtaccagaagttatcgttgcacggcactgtggacttcgagtctttggcttctcactc
atcactaacaaggtcatcatggattatgaaagcctggagaaggccaaccatgaagaagtc
ttagcagctggcaaacaagctgcacagaaattggaacagtttgtctccattcttatggcc
agcattccactccctgacaaagccagttga

DBGET integrated database retrieval system