KEGG   Homo sapiens (human): 488Help
Entry
488               CDS       T01001                                 

Gene name
ATP2A2, ATP2B, DAR, DD, SERCA2
Definition
ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 (EC:3.6.3.8)
Orthology
K05853  
Ca2+ transporting ATPase, sarcoplasmic/endoplasmic reticulum [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Thyroid hormone signaling pathway
Pancreatic secretion
Alzheimer's disease
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00715  
Darier disease
H00755  
Acrokeratosis verruciformis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    488 (ATP2A2)
   04024 cAMP signaling pathway
    488 (ATP2A2)
   04022 cGMP - PKG signaling pathway
    488 (ATP2A2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    488 (ATP2A2)
  Circulatory system
   04260 Cardiac muscle contraction
    488 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    488 (ATP2A2)
  Digestive system
   04972 Pancreatic secretion
    488 (ATP2A2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    488 (ATP2A2)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    488 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    488 (ATP2A2)
   05414 Dilated cardiomyopathy (DCM)
    488 (ATP2A2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     488 (ATP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.11
AA seq 997 aa AA seqDB search
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPAILE
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgcacaccaagacggtggaggaggtgctgggccacttcggcgtcaacgag
agtacggggctgagcctggaacaggtcaagaagcttaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagacttg
ctagttaggattttattactggcagcatgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccttttgtaattttactcatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgccatcgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtgcagcggatt
aaagctaaagacatagttcctggtgatattgtagaaattgctgttggtgacaaagttcct
gctgatataaggttaacttccatcaaatctaccacactaagagttgaccagtcaattctc
acaggtgaatctgtctctgtcatcaagcacactgatcccgtccctgacccacgagctgtc
aaccaagataaaaagaacatgctgttttctggtacaaacattgctgctgggaaagctatg
ggagtggtggtagcaactggagttaacaccgaaattggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacaccccttcagcaaaaactagatgaatttggggaacagctt
tccaaagtcatctcccttatttgcattgcagtctggatcataaatattgggcacttcaat
gacccggttcatggagggtcctggatcagaggtgctatttactactttaaaattgcagtg
gccctggctgtagcagccattcctgaaggtctgcctgcagtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccattgttcgaagcctcccgtctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacacttacaacaaaccag
atgtcagtctgcaggatgttcattctggacagagtggaaggtgatacttgttcccttaat
gagtttaccataactggatcaacttatgcacctattggagaagtgcataaagatgataaa
ccagtgaattgtcaccagtatgatggtctggtagaattagcaacaatttgtgctctttgt
aatgactctgctttggattacaatgaggcaaagggtgtgtatgaaaaagttggagaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaacgtgcaaatgcctgcaactcagtcattaaacagctgatgaaa
aaggaattcactctagagttttcacgtgacagaaagtcaatgtcggtttactgtacacca
aataaaccaagcaggacatcaatgagcaagatgtttgtgaagggtgctcctgaaggtgtc
attgacaggtgcacccacattcgagttggaagtactaaggttcctatgacctctggagtc
aaacagaagatcatgtctgtcattcgagagtggggtagtggcagcgacacactgcgatgc
ctggccctggccactcatgacaacccactgagaagagaagaaatgcaccttgaggactct
gccaactttattaaatatgagaccaatctgaccttcgttggctgcgtgggcatgctggat
cctccgagaatcgaggtggcctcctccgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcactggggacaacaagggcactgctgtggccatctgtcgccgcatcggcatc
ttcgggcaggatgaggacgtgacgtcaaaagctttcacaggccgggagtttgatgaactc
aacccctccgcccagcgagacgcctgcctgaacgcccgctgttttgctcgagttgaaccc
tcccacaagtctaaaatcgtagaatttcttcagtcttttgatgagattacagctatgact
ggcgatggcgtgaacgatgctcctgctctgaagaaagccgagattggcattgctatgggc
tctggcactgcggtggctaaaaccgcctctgagatggtcctggcggatgacaacttctcc
accattgtggctgccgttgaggaggggcgggcaatctacaacaacatgaaacagttcatc
cgctacctcatctcgtccaacgtcggggaagttgtctgtattttcctgacagcagccctt
ggatttcccgaggctttgattcctgttcagctgctctgggtcaatctggtgacagatggc
ctgcctgccactgcactggggttcaaccctcctgatctggacatcatgaataaacctccc
cggaacccaaaggaaccattgatcagcgggtggctctttttccgttacttggctattggc
tgttacgtcggcgctgctaccgtgggtgctgctgcatggtggttcattgctgctgacggt
ggtccaagagtgtccttctaccagctgagtcatttcctacagtgtaaagaggacaacccg
gactttgaaggcgtggattgtgcaatctttgaatccccatacccgatgacaatggcgctc
tctgttctagtaactatagaaatgtgtaacgccctcaacagcttgtccgaaaaccagtcc
ttgctgaggatgcccccctgggagaacatctggctcgtgggctccatctgcctgtccatg
tcactccacttcctgatcctctatgtcgaacccttgccactcatcttccagatcacaccg
ctgaacgtgacccagtggctgatggtgctgaaaatctccttgcccgtgattctcatggat
gagacgctcaagtttgtggcccgcaactacctggaacctgcaatactggagtaa

DBGET integrated database retrieval system