KEGG   Homo sapiens (human): 4920Help
Entry
4920              CDS       T01001                                 

Gene name
ROR2, BDB, BDB1, NTRKR2
Definition
receptor tyrosine kinase-like orphan receptor 2 (EC:2.7.10.1)
Orthology
K05123  
receptor tyrosine kinase-like orphan receptor 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Disease
H00482  
Brachydactyly
H00485  
Robinow syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22
AA seq 943 aa AA seqDB search
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggctcggcgctcccgcggcggccgctgctgtgcatcccggccgtctgggcg
gccgccgcgcttctgctctcagtgtcccggacttcaggtgaagtggaggttctggatccg
aacgaccctttaggaccccttgatgggcaggacggcccgattccaactctgaaaggttac
tttctgaattttctggagccagtaaacaatatcaccattgtccaaggccagacggcaatt
ctgcactgcaaggtggcaggaaacccaccccctaacgtgcggtggctaaagaatgatgcc
ccggtggtgcaggagccgcggcggatcatcatccggaagacagaatatggttcacgactg
cgaatccaggacctggacacgacagacactggctactaccagtgcgtggccaccaacggg
atgaagaccattaccgccactggcgtcctgtttgtgcggctgggtccaacgcacagccca
aatcataactttcaggatgattaccacgaggatgggttctgccagccttaccggggaatt
gcctgtgcacgcttcattggcaaccggaccatttatgtggactcgcttcagatgcagggg
gagattgaaaaccgaatcacagcggccttcaccatgatcggcacgtctacgcacctgtcg
gaccagtgctcacagttcgccatcccatccttctgccacttcgtgtttcctctgtgcgac
gcgcgctcccggacacccaagccgcgtgagctgtgccgcgacgagtgcgaggtgctggag
agcgacctgtgccgccaggagtacaccatcgcccgctccaacccgctcatcctcatgcgg
cttcagctgcccaagtgtgaggcgctgcccatgcctgagagccccgacgctgccaactgc
atgcgcattggcatcccagccgagaggctgggccgctaccatcagtgctataacggctca
ggcatggattacagaggaacggcaagcaccaccaagtcaggccaccagtgccagccgtgg
gccctgcagcacccccacagccaccacctgtccagcacagacttccctgagcttggaggg
gggcacgcctactgccggaaccccggaggccagatggagggcccctggtgctttacgcag
aataaaaacgtacgcatggaactgtgtgacgtaccctcgtgtagtccccgagacagcagc
aagatggggattctgtacatcttggtccccagcatcgcaattccactggtcatcgcttgc
cttttcttcttggtttgcatgtgccggaataagcagaaggcatctgcgtccacaccgcag
cggcgacagctgatggcctcgcccagccaagacatggaaatgcccctcattaaccagcac
aaacaggccaaactcaaagagatcagcctgtctgcggtgaggttcatggaggagctggga
gaggaccggtttgggaaagtctacaaaggtcacctgttcggccctgccccgggggagcag
acccaggctgtggccatcaaaacgctgaaggacaaagcggaggggcccctgcgggaggag
ttccggcatgaggctatgctgcgagcacggctgcaacaccccaacgtcgtctgcctgctg
ggcgtggtgaccaaggaccagcccctgagcatgatcttcagctactgttcgcacggcgac
ctccacgaattcctggtcatgcgctcgccgcactcggacgtgggcagcaccgatgatgac
cgcacggtgaagtccgccctggagccccccgacttcgtgcaccttgtggcacagatcgcg
gcggggatggagtacctatccagccaccacgtggttcacaaggacctggccacccgcaat
gtgctagtgtacgacaagctgaacgtgaagatctcagacttgggcctcttccgagaggtg
tatgccgccgattactacaagctgctggggaactcgctgctgcctatccgctggatggcc
ccagaggccatcatgtacggcaagttctccatcgactcagacatctggtcctacggtgtg
gtcctgtgggaggtcttcagctacggcctgcagccctactgcgggtactccaaccaggat
gtggtggagatgatccggaaccggcaggtgctgccttgccccgatgactgtcccgcctgg
gtgtatgccctcatgatcgagtgctggaacgagttccccagccggcggccccgcttcaag
gacatccacagccggctccgagcctggggcaacctttccaactacaacagctcggcgcag
acctcgggggccagcaacaccacgcagaccagctccctgagcaccagcccagtgagcaat
gtgagcaacgcccgctacgtggggcccaagcagaaggccccgcccttcccacagccccag
ttcatccccatgaagggccagatcagacccatggtgcccccgccgcagctctacgtcccc
gtcaacggctaccagccggtgccggcctatggggcctacctgcccaacttctacccggtg
cagatcccaatgcagatggccccgcagcaggtgcctcctcagatggtccccaagcccagc
tcacaccacagtggcagtggctccaccagcacaggctacgtcaccacggccccctccaac
acatccatggcagacagggcagccctgctctcagagggcgctgatgacacacagaacgcc
ccagaagatggggcccagagcaccgtgcaggaagcagaggaggaggaggaaggctctgtc
ccagagactgagctgctgggggactgtgacactctgcaggtggacgaggcccaagtccag
ctggaagcttga

DBGET integrated database retrieval system