KEGG   Homo sapiens (human): 4920Help
Entry
4920              CDS       T01001                                 

Gene name
ROR2, BDB, BDB1, NTRKR2
Definition
receptor tyrosine kinase-like orphan receptor 2 (EC:2.7.10.1)
Orthology
K05123  
receptor tyrosine kinase-like orphan receptor 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Disease
H00482  
Brachydactyly
H00485  
Robinow syndrome
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4920 (ROR2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Ror family
   4920 (ROR2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class XII (ROR receptor family)
   4920 (ROR2)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class XII (ROR receptor family)
   4920 (ROR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22
AA seq 943 aa AA seqDB search
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggctcggcgctcccgcggcggccgctgctgtgcatcccggccgtctgggcg
gccgccgcgcttctgctctcagtgtcccggacttcaggtgaagtggaggttctggatccg
aacgaccctttaggaccccttgatgggcaggacggcccgattccaactctgaaaggttac
tttctgaattttctggagccagtaaacaatatcaccattgtccaaggccagacggcaatt
ctgcactgcaaggtggcaggaaacccaccccctaacgtgcggtggctaaagaatgatgcc
ccggtggtgcaggagccgcggcggatcatcatccggaagacagaatatggttcacgactg
cgaatccaggacctggacacgacagacactggctactaccagtgcgtggccaccaacggg
atgaagaccattaccgccactggcgtcctgtttgtgcggctgggtccaacgcacagccca
aatcataactttcaggatgattaccacgaggatgggttctgccagccttaccggggaatt
gcctgtgcacgcttcattggcaaccggaccatttatgtggactcgcttcagatgcagggg
gagattgaaaaccgaatcacagcggccttcaccatgatcggcacgtctacgcacctgtcg
gaccagtgctcacagttcgccatcccatccttctgccacttcgtgtttcctctgtgcgac
gcgcgctcccggacacccaagccgcgtgagctgtgccgcgacgagtgcgaggtgctggag
agcgacctgtgccgccaggagtacaccatcgcccgctccaacccgctcatcctcatgcgg
cttcagctgcccaagtgtgaggcgctgcccatgcctgagagccccgacgctgccaactgc
atgcgcattggcatcccagccgagaggctgggccgctaccatcagtgctataacggctca
ggcatggattacagaggaacggcaagcaccaccaagtcaggccaccagtgccagccgtgg
gccctgcagcacccccacagccaccacctgtccagcacagacttccctgagcttggaggg
gggcacgcctactgccggaaccccggaggccagatggagggcccctggtgctttacgcag
aataaaaacgtacgcatggaactgtgtgacgtaccctcgtgtagtccccgagacagcagc
aagatggggattctgtacatcttggtccccagcatcgcaattccactggtcatcgcttgc
cttttcttcttggtttgcatgtgccggaataagcagaaggcatctgcgtccacaccgcag
cggcgacagctgatggcctcgcccagccaagacatggaaatgcccctcattaaccagcac
aaacaggccaaactcaaagagatcagcctgtctgcggtgaggttcatggaggagctggga
gaggaccggtttgggaaagtctacaaaggtcacctgttcggccctgccccgggggagcag
acccaggctgtggccatcaaaacgctgaaggacaaagcggaggggcccctgcgggaggag
ttccggcatgaggctatgctgcgagcacggctgcaacaccccaacgtcgtctgcctgctg
ggcgtggtgaccaaggaccagcccctgagcatgatcttcagctactgttcgcacggcgac
ctccacgaattcctggtcatgcgctcgccgcactcggacgtgggcagcaccgatgatgac
cgcacggtgaagtccgccctggagccccccgacttcgtgcaccttgtggcacagatcgcg
gcggggatggagtacctatccagccaccacgtggttcacaaggacctggccacccgcaat
gtgctagtgtacgacaagctgaacgtgaagatctcagacttgggcctcttccgagaggtg
tatgccgccgattactacaagctgctggggaactcgctgctgcctatccgctggatggcc
ccagaggccatcatgtacggcaagttctccatcgactcagacatctggtcctacggtgtg
gtcctgtgggaggtcttcagctacggcctgcagccctactgcgggtactccaaccaggat
gtggtggagatgatccggaaccggcaggtgctgccttgccccgatgactgtcccgcctgg
gtgtatgccctcatgatcgagtgctggaacgagttccccagccggcggccccgcttcaag
gacatccacagccggctccgagcctggggcaacctttccaactacaacagctcggcgcag
acctcgggggccagcaacaccacgcagaccagctccctgagcaccagcccagtgagcaat
gtgagcaacgcccgctacgtggggcccaagcagaaggccccgcccttcccacagccccag
ttcatccccatgaagggccagatcagacccatggtgcccccgccgcagctctacgtcccc
gtcaacggctaccagccggtgccggcctatggggcctacctgcccaacttctacccggtg
cagatcccaatgcagatggccccgcagcaggtgcctcctcagatggtccccaagcccagc
tcacaccacagtggcagtggctccaccagcacaggctacgtcaccacggccccctccaac
acatccatggcagacagggcagccctgctctcagagggcgctgatgacacacagaacgcc
ccagaagatggggcccagagcaccgtgcaggaagcagaggaggaggaggaaggctctgtc
ccagagactgagctgctgggggactgtgacactctgcaggtggacgaggcccaagtccag
ctggaagcttga

DBGET integrated database retrieval system