KEGG   Homo sapiens (human): 493856Help
Entry
493856            CDS       T01001                                 

Gene name
CISD2, ERIS, Miner1, NAF-1, WFS2, ZCD2
Definition
CDGSH iron sulfur domain 2
Organism
hsa  Homo sapiens (human)
Disease
H00854  
Wolfram syndrome (WFS)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 135 aa AA seqDB search
MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFL
PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNEL
TGDNVGPLILKKKEV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggagagcgtggcccgtatcgtgaaggtgcagctccctgcatatctgaagcgg
ctcccagtccctgaaagcattaccgggttcgctaggctcacagtttcagaatggcttcgg
ttattgcctttccttggtgtactcgcacttcttggctaccttgcagttcgtccattcctc
ccgaagaagaaacaacagaaggatagcttgattaatcttaaaatacaaaaggaaaatccg
aaagtagtgaatgaaataaacattgaagatttgtgtcttactaaagcagcttattgtagg
tgttggcgttctaaaacgtttcctgcctgcgatggttcacataataaacacaatgaattg
acaggagataatgtgggtccactaatactgaagaagaaagaagtataa

DBGET integrated database retrieval system