KEGG   Homo sapiens (human): 501Help
Entry
501               CDS       T01001                                 

Gene name
ALDH7A1, ATQ1, EPD, PDE
Definition
aldehyde dehydrogenase 7 family, member A1 (EC:1.2.1.3 1.2.1.8 1.2.1.31)
Orthology
K14085  
aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Lysine biosynthesis
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01247  
Pyridoxine-dependent epilepsy (PDE)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    501 (ALDH7A1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    501 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    501 (ALDH7A1)
   00620 Pyruvate metabolism
    501 (ALDH7A1)
  Lipid metabolism
   00071 Fatty acid degradation
    501 (ALDH7A1)
   00561 Glycerolipid metabolism
    501 (ALDH7A1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    501 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    501 (ALDH7A1)
   00300 Lysine biosynthesis
    501 (ALDH7A1)
   00310 Lysine degradation
    501 (ALDH7A1)
   00330 Arginine and proline metabolism
    501 (ALDH7A1)
   00340 Histidine metabolism
    501 (ALDH7A1)
   00380 Tryptophan metabolism
    501 (ALDH7A1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    501 (ALDH7A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     501 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     501 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     501 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31
AA seq 539 aa AA seqDB search
MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVG
NPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgccttcctcgcgcgctgtgtgtgcacgctgcaaagaccagcaagctctctgga
ccttggagcaggcctgccgccttcatgtccactctcctcatcaatcagccccagtatgcg
tggctgaaagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttattacgacctattgccctgctaacaacgagccaatagcaagagtc
cgacaggccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atctgggcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcaaggatgattggaggacctatcttgccttctgaaagatctggccatgcactgattgag
cagtggaatcccgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tatggttggaacaacgccatcgccatgatctgtggaaatgtctgcctctggaaaggagct
ccaaccacttccctcattagtgtggctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagatattggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtgggcctgatggtgcaggagaggtttgggagaagtctgttggaacttggaggaaac
aatgccattattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttc
gctgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttatacatgaa
agcatccatgatgaggttgtaaacagacttaaaaaggcctatgcacagatccgagttggg
aacccatgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacaggtcttggccacgat
gcgtccattgcacacacagagacttttgctccgattctctatgtctttaaattcaagaat
gaagaagaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcatt
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtct
acttgtactatcaactacagtaaagaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system