KEGG   Homo sapiens (human): 5015Help
Entry
5015              CDS       T01001                                 

Gene name
OTX2, CPHD6, MCOPS5
Definition
orthodenticle homeobox 2
Orthology
K09326  
homeobox protein OTX
Organism
hsa  Homo sapiens (human)
Disease
H00544  
Septo-optic dysplasia
H01027  
Anophthalmia and microphthalmia (A/M)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    5015 (OTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q22.3
AA seq 289 aa AA seqDB search
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPARE
VSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYT
QASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLST
QGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcg
ggtatggacttgctgcacccctccgtgggctacccggccaccccccggaaacagcgccgg
gagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacc
cggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcg
agggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacag
cagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaa
gtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccg
accattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactg
tcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatact
caggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggac
tgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagt
cccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacc
cagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataag
gaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcag
acatcctcgtggaaattccaggttttgtga

DBGET integrated database retrieval system