KEGG   Homo sapiens (human): 5019Help
Entry
5019              CDS       T01001                                 

Gene name
OXCT1, OXCT, SCOT
Definition
3-oxoacid CoA transferase 1 (EC:2.8.3.5)
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Disease
H01121  
Succinyl CoA:3-oxoacid CoA transferase (SCOT) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    5019 (OXCT1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    5019 (OXCT1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    5019 (OXCT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     5019 (OXCT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 520 aa AA seqDB search
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcaaactcctctcctccgggcttcggctctgcgcctctgcccgcggatct
ggggcaacctggtacaagggatgtgtttgttccttttccaccagtgctcatcgccatacc
aagttttatacagatccagtagaagctgtaaaagacatccctgatggtgccacggttttg
gttggtggttttgggctatgtggaattccagagaatcttatagatgctttactgaaaact
ggagtaaaaggactaactgcagtcagcaacaatgcaggggttgacaattttggtttgggg
cttttgcttcggtccaagcagataaaacgcatggtctcttcatatgtgggagaaaatgca
gaatttgaacgacagtacttatctggtgaattagaagtggagctgacaccacagggcaca
cttgcagagaggatccgtgcaggcggggctggagttcctgcattttacaccccaacaggg
tatgggaccctggtacaagaaggaggatcgcccatcaaatacaacaaagatggcagtgtt
gccattgccagtaagccaagagaggtgagggagttcaatggtcagcactttattttggag
gaagcaattacaggggattttgctttggtgaaagcctggaaggcggaccgagcaggaaac
gtgattttcaggaaaagtgcaaggaatttcaacttgccaatgtgcaaagctgcagaaacc
acagtggtagaggttgaagaaattgtggatattggagcatttgctccagaagacatccat
attcctcagatttatgtacatcgccttataaagggagaaaaatatgagaaaagaattgag
cgtttatcaatccggaaagagggagatggggaagccaaatctgctaaacctggagatgac
gtaagggaacgaatcatcaagagggccgctcttgagtttgaggatggcatgtatgctaat
ttgggcataggaatccctctcctggccagcaattttatcagcccaaatataactgttcat
cttcaaagtgaaaatggagttctgggtttgggtccatatccacgacaacatgaagctgat
gcagatctcatcaatgcaggcaaggaaacagttactattcttccaggagcctcttttttc
tccagcgatgaatcatttgcaatgattagaggtggacacgtcgatctgacaatgctagga
gcgatgcaggtttccaaatatggtgacctggctaactggatgatacctgggaagatggtg
aaaggaatgggaggtgctatggatttagtgtccagtgcgaaaaccaaagtggtggtcacc
atggagcattctgcaaagggaaatgcacataaaatcatggagaaatgtacattaccattg
actggaaagcaatgtgtcaaccgcattattactgaaaaggctgtgtttgatgtggacaag
aagaaagggttgactctgattgagctctgggaaggcctgacagtggatgacgtacagaag
agtactgggtgtgattttgcagtttcaccaaaactcatgccaatgcagcagatcgcaaat
tga

DBGET integrated database retrieval system