KEGG   Homo sapiens (human): 50506Help
Entry
50506             CDS       T01001                                 

Gene name
DUOX2, LNOX2, NOXEF2, P138-TOX, TDH6, THOX2
Definition
dual oxidase 2 (EC:1.6.3.1)
Orthology
K13411  
dual oxidase [EC:1.6.3.1 1.11.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone synthesis
Disease
H00251  
Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    50506 (DUOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.1  NAD(P)H oxidase (H2O2-forming)
     50506 (DUOX2)
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     50506 (DUOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15.3
AA seq 1548 aa AA seqDB search
MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRR
VPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVE
TPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLD
GSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYE
WLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKG
FQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLS
QLELLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTL
RDVLVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAI
TIIALCCLPLVSLLLSGVVAYFRGREHKKLQKKLKESVKKEAAKDGVPAMEWPGPKERSS
PIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNNRGCRTLLLKIPKEYDLVLLF
SSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVL
DINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQL
AEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNI
SCRVSFITRTPGERSHPQGLGPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQ
RGFLAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGI
ILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAIL
HSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLA
IMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTL
TSAPHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVS
VLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEEND
HQDLVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFN
SLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF
NT seq 4647 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtgcaagaccagaggcactgatgctcctgggagctcttctgactggatccctg
ggtccatcgggcaatcaggacgcactctcactgccctgggaagtgcagcgctatgacggc
tggtttaacaacctgaggcaccacgagcgtggtgctgttggctgccggttgcagcgccgc
gtaccagccaattacgccgacggtgtgtatcaggctctggaggagccgcagctgcccaac
ccgcgccggctcagcaacgcagccacgcggggcatagccggcctgccgtcgctccacaac
cgcaccgtactgggggtcttctttggctaccatgttctttccgacgtggtgagcgtggaa
acgcccggttgccccgccgagttcctcaacatccgcatcccacctggagaccccgtgttc
gaccccgaccagcgcggggacgtggtgctgcccttccagaggagccgctgggaccccgag
accggacggagtcccagcaacccccgggacctggccaaccaggtgacgggctggctggac
ggcagcgccatctatggctcctcgcactcctggagcgacgcgctgcggagcttctcgggg
ggacagctggcgtcggggcccgaccccgctttcccccgagactcgcagaaccccctgctc
atgtgggcggcgcccgaccccgccaccgggcagaacgggccccgggggctgtacgccttc
ggggcagagagagggaaccgggaacccttcctgcaggcgctgggcctgctctggttccgc
taccacaacctgtgggcgcagaggctggcccgccagcacccagactgggaggacgaggag
ctgttccagcacgcacgcaagagggtcatcgccacctaccagaacatcgctgtgtatgag
tggctgcccagcttcctgcagaaaacactcccggagtatacaggataccgtcctttccta
gaccccagcatctccccggaatttgtggtggcctctgagcagttcttctctaccatggtg
ccccctggtgtctacatgagaaatgccagctgtcatttccggaaggtcctgaacaagggt
tttcaaagctcccaagctctcagggtctgcaacaactactggattcgggagaaccccaat
ctgaacagtacccaggaggtgaatgagctgctgctgggaatggcctcccagatttcggag
ttggaggacaacatagtggttgaagatctgagggattactggcctggccctggcaaattc
tcccgtacagactatgtggccagcagcatccaacgtggccgagatatggggctgcccagc
tatagccaggccctgctggcctttgggctggacatcccaaggaactggagtgatctcaac
cctaatgtggacccccaggtgctggaggccacagctgccctgtacaaccaggacctatcc
cagctagagctgctccttggggggctcctggagagccatggggaccctggacccctgttc
agtgccattgtcctcgaccagtttgtacggctgcgggatggtgaccgctactggtttgag
aacaccaggaatgggctgttctccaagaaggagattgaagacatccgaaataccaccctg
cgggacgtgctggtcgctgttatcaacattgaccccagtgccctgcagcccaatgtcttt
gtctggcataaaggtgcaccctgccctcaacctaagcagctcacaactgacggcctgccc
cagtgtgcacccctgactgtgcttgacttctttgaaggcagcagccctggttttgccatc
accatcattgctctctgctgccttcccttagtgagtctgcttctctctggagtggtggcc
tatttccggggccgagaacacaagaagctacaaaagaaactcaaagagagcgtgaagaag
gaagcagccaaagatggagtgccagcgatggagtggccaggccccaaggagaggagcagt
cccatcatcatccagctgctgtcagacaggtgtctgcaggtcctgaacaggcatctcact
gtgctccgtgtggtccagctgcagcctctgcagcaggtcaacctcatcctgtccaacaac
cgaggatgccgcaccctgctgctcaagatccctaaggagtatgacctggtgctgctgttt
agttctgaagaggaacggggcgcctttgtgcagcagctatgggacttctgcgtgcgctgg
gctctgggcctccatgtggctgagatgagcgagaaggagctatttaggaaggctgtgaca
aagcagcagcgggaacgcatcctggagatcttcttcagacacctttttgctcaggtgctg
gacatcaaccaggccgacgcagggaccctgcccctggactcctcccagaaggtgcgggag
gccctgacctgcgagctgagcagggccgagtttgccgagtccctgggcctcaagccccag
gacatgtttgtggagtccatgttctctctggctgacaaggatggcaatggctacctgtcc
ttccgagagttcctggacatcctggtggtcttcatgaaaggctccccagaggataagtcc
cgtctaatgtttaccatgtatgacctggatgagaatggcttcctctccaaggacgaattc
ttcaccatgatgcgatccttcatcgagatctccaacaactgcctgtccaaggcccagctg
gccgaggtggtggagtctatgttccgggagtcgggattccaggacaaggaggagctgaca
tgggaggattttcacttcatgctgcgggaccatgacagcgagctccgcttcacgcagctc
tgtgtcaaaggtggaggtggaggtggaaatggtattagagatatctttaaacaaaacatc
agctgtcgagtctcgttcatcactcggacacctggggagcgctcccacccccagggactg
gggccccctgccccagaagccccagagctgggaggccctggactgaagaagaggtttggc
aaaaaggcagcagtgcccactccccggctgtacacagaggcgctgcaagagaagatgcag
cgaggcttcctagcccaaaagctgcagcagtacaagcgcttcgtggagaactaccggagg
cacatcgtgtgtgtggcaatcttctcggccatctgtgttggcgtgtttgcagatcgtgct
tactactatggctttgcctcgccaccctcggacattgcacagaccaccctcgtgggcatc
atcctgtcacgaggcacggcggccagcgtctccttcatgttctcttatatcttgctcacc
atgtgccgcaacctcataaccttcctgcgagagactttcctcaaccgctatgtgcctttt
gatgccgcagtggacttccaccgctggatcgccatggctgctgttgtcctggccattttg
cacagtgctggccacgcagtcaatgtctacatcttctcagtcagcccactcagcctgctg
gcctgcatattccccaacgtctttgtgaatgatgggtccaagcttccccagaagttctat
tggtggttcttccagaccgtcccaggtatgacaggtgtgcttctgctcctggtcctggcc
atcatgtatgtcttcgcctcccaccacttccgccgccgcagcttccggggcttctggctg
acccaccacctctacatcctgctctatgccctgctcatcatccatggcagctatgctctg
atccagctgcccactttccacatctacttcctggtcccggcaatcatctatggaggtgac
aagctggtgagcctgagccggaagaaggtggagatcagcgtggtgaaggcggagctgctg
ccctcaggagtgacctacctgcaattccagaggccccaaggctttgagtacaagtcagga
cagtgggtgcggatcgcctgcctggctctggggaccaccgagtaccaccccttcacactg
acctccgcgccccatgaggacacactcagcctgcacatccgggcagtggggccctggacc
actcgcctcagggagatctactcatccccaaagggcaatggctgtgctggatacccaaag
ctgtaccttgatggaccgtttggagagggccatcaggagtggcataaatttgaggtgtca
gtgttggtgggagggggcattggggtcaccccctttgcctccatcctcaaagacctggtc
ttcaagtcatccttgggcagccaaatgctgtgtaagaagatctacttcatctgggtgaca
cggacccagcgtcagtttgagtggctggctgacatcatccaagaggtggaggagaacgac
caccaggacctggtgtctgtgcacatttatgtcacccagctggctgagaagttcgacctc
aggaccaccatgctatacatctgcgagcggcacttccagaaagtgctgaaccggagtctg
ttcacgggcctgcgctccatcacccactttggccgtccccccttcgagcccttcttcaac
tccctgcaggaggtccacccacaggtgcgcaagatcggggtgttcagctgcggccctcca
ggaatgaccaagaatgtagagaaggcctgtcagctcgtcaacaggcaggaccgagcccac
ttcatgcaccactatgagaacttctga

DBGET integrated database retrieval system