KEGG   Homo sapiens (human): 506Help
Entry
506               CDS       T01001                                 

Gene name
ATP5F1B, ATP5B, ATPMB, ATPSB, HEL-S-271
Definition
(RefSeq) ATP synthase F1 subunit beta
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    506 (ATP5F1B)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    506 (ATP5F1B)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    506 (ATP5F1B)
   05012 Parkinson's disease
    506 (ATP5F1B)
   05016 Huntington's disease
    506 (ATP5F1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     506 (ATP5F1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 RsgA_GTPase ATPase NACHT AAA NB-ARC AAA_19 AAA_16 ABC_tran DUF2075
Motif
Other DBs
NCBI-GeneID: 506
NCBI-ProteinID: NP_001677
OMIM: 102910
HGNC: 830
Ensembl: ENSG00000110955
Pharos: P06576(Tbio)
UniProt: P06576 V9HW31
Position
12q13.3
AA seq 529 aa AA seqDB search
MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggggtttgtgggtcgggtggccgctgctccggcctccggggccttgcggagactc
accccttcagcgtcgctgcccccagctcagctcttactgcgggccgctccgacggcggtc
catcctgtcagggactatgcggcgcaaacatctccttcgccaaaagcaggcgccgccacc
gggcgcatcgtggcggtcattggcgcagtggtggacgtccagtttgatgagggactacca
ccaattctaaatgccctggaagtgcaaggcagggagaccagactggttttggaggtggcc
cagcatttgggtgagagcacagtaaggactattgctatggatggtacagaaggcttggtt
agaggccagaaagtactggattctggtgcaccaatcaaaattcctgttggtcctgagact
ttgggcagaatcatgaatgtcattggagaacctattgatgaaagaggtcccatcaaaacc
aaacaatttgctcccattcatgctgaggctccagagttcatggaaatgagtgttgagcag
gaaattctggtgactggtatcaaggttgtcgatctgctagctccctatgccaagggtggc
aaaattgggctttttggtggtgctggagttggcaagactgtactgatcatggagttaatc
aacaatgtcgccaaagcccatggtggttactctgtgtttgctggtgttggtgagaggacc
cgtgaaggcaatgatttataccatgaaatgattgaatctggtgttatcaacttaaaagat
gccacctctaaggtagcgctggtatatggtcaaatgaatgaaccacctggtgctcgtgcc
cgggtagctctgactgggctgactgtggctgaatacttcagagaccaagaaggtcaagat
gtactgctatttattgataacatctttcgcttcacccaggctggttcagaggtgtctgca
ttattgggccgaatcccttctgctgtgggctatcagcctaccctggccactgacatgggt
actatgcaggaaagaattaccactaccaagaagggatctatcacctctgtacaggctatc
tatgtgcctgctgatgacttgactgaccctgcccctgctactacgtttgcccatttggat
gctaccactgtactgtcgcgtgccattgctgagctgggcatctatccagctgtggatcct
ctagactccacctctcgtatcatggatcccaacattgttggcagtgagcattacgatgtt
gcccgtggggtgcaaaagatcctgcaggactacaaatccctccaggatatcattgccatc
ctgggtatggatgaactttctgaggaagacaagttgaccgtgtcccgtgcacggaaaata
cagcgtttcttgtctcagccattccaggttgctgaggtcttcacaggtcatatggggaag
ctggtacccctgaaggagaccatcaaaggattccagcagattttggcaggtgaatatgac
catctcccagaacaggccttctatatggtgggacccattgaagaagctgtggcaaaagct
gataagctggctgaagagcattcatcgtga

DBGET integrated database retrieval system