KEGG   Homo sapiens (human): 50964Help
Entry
50964             CDS       T01001                                 

Gene name
SOST, CDD, SOST1, VBCH
Definition
sclerostin
Orthology
K16834  
sclerostin
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Disease
H00486  
SOST related disorders
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    50964 (SOST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 213 aa AA seqDB search
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE
NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG
RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK
DFGTEAARPQKGRKPRPRARSAKANQAELENAY
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcccactggccctgtgtctcgtctgcctgctggtacacacagccttccgtgta
gtggagggccaggggtggcaggcgttcaagaatgatgccacggaaatcatccccgagctc
ggagagtaccccgagcctccaccggagctggagaacaacaagaccatgaaccgggcggag
aacggagggcggcctccccaccacccctttgagaccaaagacgtgtccgagtacagctgc
cgcgagctgcacttcacccgctacgtgaccgatgggccgtgccgcagcgccaagccggtc
accgagctggtgtgctccggccagtgcggcccggcgcgcctgctgcccaacgccatcggc
cgcggcaagtggtggcgacctagtgggcccgacttccgctgcatccccgaccgctaccgc
gcgcagcgcgtgcagctgctgtgtcccggtggtgaggcgccgcgcgcgcgcaaggtgcgc
ctggtggcctcgtgcaagtgcaagcgcctcacccgcttccacaaccagtcggagctcaag
gacttcgggaccgaggccgctcggccgcagaagggccggaagccgcggccccgcgcccgg
agcgccaaagccaaccaggccgagctggagaacgcctactag

DBGET integrated database retrieval system