KEGG   Homo sapiens (human): 51082Help
Entry
51082             CDS       T01001                                 

Gene name
POLR1D, AC19, POLR1C, RPA16, RPA9, RPAC2, RPC16, RPO1-3, TCS2
Definition
polymerase (RNA) I polypeptide D, 16kDa
Orthology
K03020  
DNA-directed RNA polymerases I and III subunit RPAC2
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Cytosolic DNA-sensing pathway
Epstein-Barr virus infection
Module
RNA polymerase III, eukaryotes
RNA polymerase I, eukaryotes
Disease
H00610  
Treacher Collins syndrome
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:hsa03020]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.2
AA seq 94 aa AA seqDB search
MGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRS
HPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggacccatgggttggatgaagtgtcctcttgctagcaccaataaaagatttctaatt
aacacaattaaaaacacattgccctctcataaagagcaagaccatgaacaaaaagagggc
gataaggaaccagcgaagagccaggcccagaaagaagaaaacccgaagaaacacagaagc
catccttacaagcacagcttccgcgctcgaggttccgccagttactccccgccacgaaag
cggagcagccaggacaagtacgaaaagcggtccaaccggcggtga

DBGET integrated database retrieval system