KEGG   Homo sapiens (human): 51129Help
Entry
51129             CDS       T01001                                 

Gene name
ANGPTL4, ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158
Definition
(RefSeq) angiopoietin like 4
  KO
K08767  
angiopoietin-like 4
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    51129 (ANGPTL4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51129 (ANGPTL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 406 aa AA seqDB search
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgctccgacggccggggcagccctgatgctctgcgccgccaccgccgtgcta
ctgagcgctcagggcggacccgtgcagtccaagtcgccgcgctttgcgtcctgggacgag
atgaatgtcctggcgcacggactcctgcagctcggccaggggctgcgcgaacacgcggag
cgcacccgcagtcagctgagcgcgctggagcggcgcctgagcgcgtgcgggtccgcctgt
cagggaaccgaggggtccaccgacctcccgttagcccctgagagccgggtggaccctgag
gtccttcacagcctgcagacacaactcaaggctcagaacagcaggatccagcaactcttc
cacaaggtggcccagcagcagcggcacctggagaagcagcacctgcgaattcagcatctg
caaagccagtttggcctcctggaccacaagcacctagaccatgaggtggccaagcctgcc
cgaagaaagaggctgcccgagatggcccagccagttgacccggctcacaatgtcagccgc
ctgcaccggctgcccagggattgccaggagctgttccaggttggggagaggcagagtgga
ctatttgaaatccagcctcaggggtctccgccatttttggtgaactgcaagatgacctca
gatggaggctggacagtaattcagaggcgccacgatggctcagtggacttcaaccggccc
tgggaagcctacaaggcggggtttggggatccccacggcgagttctggctgggtctggag
aaggtgcatagcatcacgggggaccgcaacagccgcctggccgtgcagctgcgggactgg
gatggcaacgccgagttgctgcagttctccgtgcacctgggtggcgaggacacggcctat
agcctgcagctcactgcacccgtggccggccagctgggcgccaccaccgtcccacccagc
ggcctctccgtacccttctccacttgggaccaggatcacgacctccgcagggacaagaac
tgcgccaagagcctctctggaggctggtggtttggcacctgcagccattccaacctcaac
ggccagtacttccgctccatcccacagcagcggcagaagcttaagaagggaatcttctgg
aagacctggcggggccgctactacccgctgcaggccaccaccatgttgatccagcccatg
gcagcagaggcagcctcctag

DBGET integrated database retrieval system