KEGG   Homo sapiens (human): 51135Help
Entry
51135             CDS       T01001                                 

Gene name
IRAK4, IPD1, IRAK-4, NY-REN-64, REN64
Definition
interleukin-1 receptor-associated kinase 4 (EC:2.7.11.1)
Orthology
K04733  
interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Disease
H00096  
Defects of toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    51135 (IRAK4)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    51135 (IRAK4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    51135 (IRAK4)
  Nervous system
   04722 Neurotrophin signaling pathway
    51135 (IRAK4)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    51135 (IRAK4)
   05152 Tuberculosis
    51135 (IRAK4)
   05162 Measles
    51135 (IRAK4)
   05164 Influenza A
    51135 (IRAK4)
   05145 Toxoplasmosis
    51135 (IRAK4)
   05140 Leishmaniasis
    51135 (IRAK4)
   05142 Chagas disease (American trypanosomiasis)
    51135 (IRAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51135 (IRAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  IRAK family
   51135 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q12
AA seq 460 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccatcaacatatgtgcgctgcctcaatgttggactaattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaattactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctataacagtt
cagcaaaaacagatgcctttctgtgacaaagacaggacattgatgacacctgtgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgttttcacagtttttcattttatgaattgaagaatgtcacaaataacttt
gatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagttgta
tataaaggctacgtaaataacacaactgtggcagtgaagaagcttgcagcaatggttgac
attactactgaagaactgaaacagcagtttgatcaagaaataaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtatatgtttacatgcctaatggttcattgctagacagactctcttgcttggatggtact
ccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatcaat
tttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactggat
gaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaattgtgggaacaacagcttatatggcaccagaagctttg
cgtggagaaataacacccaaatctgatatttacagctttggtgtggttttactagaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttattgctagatattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatattgataaaaagatgaatgat
gctgattccacttcagttgaagctatgtactctgttgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagcttct
taa

DBGET integrated database retrieval system