KEGG   Homo sapiens (human): 51441Help
Entry
51441             CDS       T01001                                 

Gene name
YTHDF2, CAHL, HGRG8, NY-REN-2
Definition
(RefSeq) YTH N6-methyladenosine RNA binding protein 2
  KO
K20102  
YTH domain-containing family protein
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51441 (YTHDF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35
AA seq 579 aa AA seqDB search
MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccagcagcctcttggagcagagaccaaaaggtcaaggaaacaaagtacaaaat
ggatctgtacatcaaaaggatggattaaacgatgatgattttgaaccttacttgagtcca
caggcaaggcccaataatgcatatactgccatgtcagattcctacttacccagttactac
agtccctccattggcttctcctattctttgggtgaagctgcttggtctacggggggtgac
acagccatgccctacttaacttcttatggacagctgagcaacggagagccccacttccta
ccagatgcaatgtttgggcaaccaggagccctaggtagcactccatttcttggtcagcat
ggttttaatttctttcccagtgggattgacttctcagcatggggaaataacagttctcag
ggacagtctactcagagctctggatatagtagcaattatgcttatgcacctagctcctta
ggtggagccatgattgatggacagtcagcttttgccaatgagaccctcaataaggctcct
ggcatgaatactatagaccaagggatggcagcactgaagttgggtagcacagaagttgca
agcaatgttccaaaagttgtaggttctgctgttggtagcgggtccattactagtaacatc
gtggcttccaatagtttgcctccagccaccattgctcctccaaaaccagcatcttgggct
gatattgctagcaagcctgcaaaacagcaacctaaactgaagaccaagaatggcattgca
gggtcaagtcttccgccacccccgataaagcataacatggatattggaacttgggataac
aagggtcccgttgcaaaagccccctcacaggctttggttcagaatataggtcagccaacc
caggggtctcctcagcctgtaggtcagcaggctaacaatagcccaccagtggctcaggca
tcagtagggcaacagacacagccattgcctccacctccaccacagcctgcccagctttca
gtccagcaacaggcagctcagccaacccgctgggtagcacctcggaaccgtggcagtggg
ttcggtcataatggggtggatggtaatggagtaggacagtctcaggctggttctggatct
actccttcagaaccccacccagtgttggagaagcttcggtccattaataactataacccc
aaagattttgactggaatctgaaacatggccgggttttcatcattaagagctactctgag
gacgatattcaccgttccattaagtataatatttggtgcagcacagagcatggtaacaag
agactggatgctgcttatcgttccatgaacgggaaaggccccgtttacttacttttcagt
gtcaacggcagtggacacttctgtggcgtggcagaaatgaaatctgctgtggactacaac
acatgtgcaggtgtgtggtcccaggacaaatggaagggtcgttttgatgtcaggtggatt
tttgtgaaggacgttcccaatagccaactgcgacacattcgcctagagaacaacgagaat
aaaccagtgaccaactctagggacactcaggaagtgcctctggaaaaggctaagcaggtg
ttgaaaattatagccagctacaagcacaccacttccatttttgatgacttctcacactat
gagaaacgccaagaggaagaagaaagtgttaaaaaggaacgtcaaggtcgtgggaaataa

DBGET integrated database retrieval system