KEGG   Homo sapiens (human): 5155Help
Entry
5155              CDS       T01001                                 

Gene name
PDGFB, IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis
Definition
platelet-derived growth factor beta polypeptide
Orthology
K17386  
platelet-derived growth factor subunit B
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Glioma
Prostate cancer
Melanoma
Disease
H00015  
Malignant pleural mesothelioma
H00042  
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5155 (PDGFB)
   04015 Rap1 signaling pathway
    5155 (PDGFB)
   04010 MAPK signaling pathway
    5155 (PDGFB)
   04151 PI3K-Akt signaling pathway
    5155 (PDGFB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5155 (PDGFB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5155 (PDGFB)
  Cellular commiunity
   04510 Focal adhesion
    5155 (PDGFB)
   04540 Gap junction
    5155 (PDGFB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5155 (PDGFB)
   05206 MicroRNAs in cancer
    5155 (PDGFB)
   05214 Glioma
    5155 (PDGFB)
   05218 Melanoma
    5155 (PDGFB)
   05211 Renal cell carcinoma
    5155 (PDGFB)
   05215 Prostate cancer
    5155 (PDGFB)
  Infectious diseases
   05166 HTLV-I infection
    5155 (PDGFB)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    5155 (PDGFB)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  5155 (PDGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 241 aa AA seqDB search
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccattgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

DBGET integrated database retrieval system