KEGG   Homo sapiens (human): 5155Help
Entry
5155              CDS       T01001                                 

Gene name
PDGFB, IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis
Definition
platelet-derived growth factor beta polypeptide
Orthology
K17386  
platelet-derived growth factor subunit B
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Glioma
Prostate cancer
Melanoma
Disease
H00015  
Malignant pleural mesothelioma
H00042  
Glioma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 241 aa AA seqDB search
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccattgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

DBGET integrated database retrieval system