KEGG   Homo sapiens (human): 5160Help
Entry
5160              CDS       T01001                                 

Gene name
PDHA1, PDHA, PDHCE1A, PHE1A
Definition
pyruvate dehydrogenase (lipoamide) alpha 1 (EC:1.2.4.1)
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
H01354  
Leigh syndrome
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.1
AA seq 390 aa AA seqDB search
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagatgctcgccgccgtctcccgcgtgctgtctggcgcttctcagaagccggca
agcagagtgctggtagcatcccgtaattttgcaaatgatgctacatttgaaattaagaaa
tgtgaccttcaccggctggaagaaggccctcctgtcacaacagtgctcaccagggaggat
gggctcaaatactacaggatgatgcagactgtacgccgaatggagttgaaagcagatcag
ctgtataaacagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcttgc
tgtgtgggcctggaggccggcatcaaccccacagaccatctcatcacagcctaccgggct
cacggctttactttcacccggggcctttccgtccgagaaattctcgcagagcttacagga
cgaaaaggaggttgtgctaaagggaaaggaggatcgatgcacatgtatgccaagaacttc
tacgggggcaatggcatcgtgggagcgcaggtgcccctgggcgctgggattgctctagcc
tgtaagtataatggaaaagatgaggtctgcctgactttatatggcgatggtgctgctaac
cagggccagatattcgaagcttacaacatggcagctttgtggaaattaccttgtattttc
atctgtgagaataatcgctatggaatgggaacgtctgttgagagagcggcagccagcact
gattactacaagagaggcgatttcattcctgggctgagagtggatggaatggatatcctg
tgcgtccgagaggcaacaaggtttgctgctgcctattgtagatctgggaaggggcccatc
ctgatggagctgcagacttaccgttaccacggacacagtatgagtgaccctggagtcagt
taccgtacacgagaagaaattcaggaagtaagaagtaagagtgaccctattatgcttctc
aaggacaggatggtgaacagcaatcttgccagtgtggaagaactaaaggaaattgatgtg
gaagtgaggaaggagattgaggatgctgcccagtttgccacggccgatcctgagccacct
ttggaagagctgggctaccacatctactccagcgacccaccttttgaagttcgtggtgcc
aatcagtggatcaagtttaagtcagtcagttaa

DBGET integrated database retrieval system