KEGG   Homo sapiens (human): 5175Help
Entry
5175              CDS       T01001                                 

Gene name
PECAM1, CD31, CD31/EndoCAM, GPIIA', PECA1, PECAM-1, endoCAM
Definition
platelet/endothelial cell adhesion molecule 1
Orthology
K06471  
platelet/endothelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Leukocyte transendothelial migration
Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5175 (PECAM1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    5175 (PECAM1)
 Human Diseases
  Infectious diseases
   05144 Malaria
    5175 (PECAM1)
Cellular antigens [BR:hsa04090]
 Proteins
  5175 (PECAM1)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
  5175 (PECAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 738 aa AA seqDB search
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgaggtgggcccaaggggccacgatgtggcttggagtcctgctgacccttctg
ctctgttcaagccttgagggtcaagaaaactctttcacaatcaacagtgttgacatgaag
agcctgccggactggacggtgcaaaatgggaagaacctgaccctgcagtgcttcgcggat
gtcagcaccacctctcacgtcaagcctcagcaccagatgctgttctataaggatgacgtg
ctgttttacaacatctcctccatgaagagcacagagagttattttattcctgaagtccgg
atctatgactcagggacatataaatgtactgtgattgtgaacaacaaagagaaaaccact
gcagagtaccaggtgttggtggaaggagtgcccagtcccagggtgacactggacaagaaa
gaggccatccaaggtgggatcgtgagggtcaactgttctgtcccagaggaaaaggcccca
atacacttcacaattgaaaaacttgaactaaatgaaaaaatggtcaagctgaaaagagag
aagaattctcgagaccagaattttgtgatactggaattccccgttgaggaacaggaccgc
gttttatccttccgatgtcaagctaggatcatttctgggatccatatgcagacctcagaa
tctaccaagagtgaactggtcaccgtgacggaatccttctctacacccaagttccacatc
agccccaccggaatgatcatggaaggagctcagctccacattaagtgcaccattcaagtg
actcacctggcccaggagtttccagaaatcataattcagaaggacaaggcgattgtggcc
cacaacagacatggcaacaaggctgtgtactcagtcatggccatggtggagcacagtggc
aactacacgtgcaaagtggagtccagccgcatatccaaggtcagcagcatcgtggtcaac
ataacagaactattttccaagcccgaactggaatcttccttcacacatctggaccaaggt
gaaagactgaacctgtcctgctccatcccaggagcacctccagccaacttcaccatccag
aaggaagatacgattgtgtcacagactcaagatttcaccaagatagcctcaaagtcggac
agtgggacgtatatctgcactgcaggtattgacaaagtggtcaagaaaagcaacacagtc
cagatagtcgtatgtgaaatgctctcccagcccaggatttcttatgatgcccagtttgag
gtcataaaaggacagaccatcgaagtccgttgcgaatcgatcagtggaactttgcctatt
tcttaccaacttttaaaaacaagtaaagttttggagaatagtaccaagaactcaaatgat
cctgcggtattcaaagacaaccccactgaagacgtcgaataccagtgtgttgcagataat
tgccattcccatgccaaaatgttaagtgaggttctgagggtgaaggtgatagccccggtg
gatgaggtccagatttctatcctgtcaagtaaggtggtggagtctggagaggacattgtg
ctgcaatgtgctgtgaatgaaggatctggtcccatcacctataagttttacagagaaaaa
gagggcaaacccttctatcaaatgacctcaaatgccacccaggcattttggaccaagcag
aaggctagcaaggaacaggagggagagtattactgcacagccttcaacagagccaaccac
gcctccagtgtccccagaagcaaaatactgacagtcagagtcattcttgccccatggaag
aaaggacttattgcagtggttatcatcggagtgatcattgctctcttgatcattgcggcc
aaatgttattttctgaggaaagccaaggccaagcagatgccagtggaaatgtccaggcca
gcagtaccacttctgaactccaacaacgagaaaatgtcagatcccaatatggaagctaac
agtcattacggtcacaatgacgatgtcagaaaccatgcaatgaaaccaataaatgataat
aaagagcctctgaactcagacgtgcagtacacggaagttcaagtgtcctcagctgagtct
cacaaagatctaggaaagaaggacacagagacagtgtacagtgaagtccggaaagctgtc
cctgatgccgtggaaagcagatactctagaacggaaggctcccttgatggaacttag

DBGET integrated database retrieval system