KEGG   Homo sapiens (human): 5175Help
Entry
5175              CDS       T01001                                 

Gene name
PECAM1, CD31, CD31/EndoCAM, GPIIA', PECA1, PECAM-1, endoCAM
Definition
platelet/endothelial cell adhesion molecule 1
Orthology
K06471  
platelet/endothelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Leukocyte transendothelial migration
Malaria
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 738 aa AA seqDB search
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgaggtgggcccaaggggccacgatgtggcttggagtcctgctgacccttctg
ctctgttcaagccttgagggtcaagaaaactctttcacaatcaacagtgttgacatgaag
agcctgccggactggacggtgcaaaatgggaagaacctgaccctgcagtgcttcgcggat
gtcagcaccacctctcacgtcaagcctcagcaccagatgctgttctataaggatgacgtg
ctgttttacaacatctcctccatgaagagcacagagagttattttattcctgaagtccgg
atctatgactcagggacatataaatgtactgtgattgtgaacaacaaagagaaaaccact
gcagagtaccaggtgttggtggaaggagtgcccagtcccagggtgacactggacaagaaa
gaggccatccaaggtgggatcgtgagggtcaactgttctgtcccagaggaaaaggcccca
atacacttcacaattgaaaaacttgaactaaatgaaaaaatggtcaagctgaaaagagag
aagaattctcgagaccagaattttgtgatactggaattccccgttgaggaacaggaccgc
gttttatccttccgatgtcaagctaggatcatttctgggatccatatgcagacctcagaa
tctaccaagagtgaactggtcaccgtgacggaatccttctctacacccaagttccacatc
agccccaccggaatgatcatggaaggagctcagctccacattaagtgcaccattcaagtg
actcacctggcccaggagtttccagaaatcataattcagaaggacaaggcgattgtggcc
cacaacagacatggcaacaaggctgtgtactcagtcatggccatggtggagcacagtggc
aactacacgtgcaaagtggagtccagccgcatatccaaggtcagcagcatcgtggtcaac
ataacagaactattttccaagcccgaactggaatcttccttcacacatctggaccaaggt
gaaagactgaacctgtcctgctccatcccaggagcacctccagccaacttcaccatccag
aaggaagatacgattgtgtcacagactcaagatttcaccaagatagcctcaaagtcggac
agtgggacgtatatctgcactgcaggtattgacaaagtggtcaagaaaagcaacacagtc
cagatagtcgtatgtgaaatgctctcccagcccaggatttcttatgatgcccagtttgag
gtcataaaaggacagaccatcgaagtccgttgcgaatcgatcagtggaactttgcctatt
tcttaccaacttttaaaaacaagtaaagttttggagaatagtaccaagaactcaaatgat
cctgcggtattcaaagacaaccccactgaagacgtcgaataccagtgtgttgcagataat
tgccattcccatgccaaaatgttaagtgaggttctgagggtgaaggtgatagccccggtg
gatgaggtccagatttctatcctgtcaagtaaggtggtggagtctggagaggacattgtg
ctgcaatgtgctgtgaatgaaggatctggtcccatcacctataagttttacagagaaaaa
gagggcaaacccttctatcaaatgacctcaaatgccacccaggcattttggaccaagcag
aaggctagcaaggaacaggagggagagtattactgcacagccttcaacagagccaaccac
gcctccagtgtccccagaagcaaaatactgacagtcagagtcattcttgccccatggaag
aaaggacttattgcagtggttatcatcggagtgatcattgctctcttgatcattgcggcc
aaatgttattttctgaggaaagccaaggccaagcagatgccagtggaaatgtccaggcca
gcagtaccacttctgaactccaacaacgagaaaatgtcagatcccaatatggaagctaac
agtcattacggtcacaatgacgatgtcagaaaccatgcaatgaaaccaataaatgataat
aaagagcctctgaactcagacgtgcagtacacggaagttcaagtgtcctcagctgagtct
cacaaagatctaggaaagaaggacacagagacagtgtacagtgaagtccggaaagctgtc
cctgatgccgtggaaagcagatactctagaacggaaggctcccttgatggaacttag

DBGET integrated database retrieval system