KEGG   Homo sapiens (human): 5184Help
Entry
5184              CDS       T01001                                 

Gene name
PEPD, PROLIDASE
Definition
peptidase D (EC:3.4.13.9)
Orthology
K14213  
Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
hsa  Homo sapiens (human)
Disease
H01119  
Prolidase deficiency (PD)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.11
AA seq 493 aa AA seqDB search
MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTD
TGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEK
YAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEI
VECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSS
YTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTA
DQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLG
AVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH
LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMA
GCDKAFTPFSGPK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaccggaccctcgttttggctggggaatgaaaccctgaaggtgccgctg
gcgctctttgccttgaaccggcagcgcctgtgtgagcggctgcggaagaaccctgctgtg
caggccggctccatcgtggtcctgcagggcggggaggagactcagcgctactgcaccgac
accggggtcctcttccgccaggagtccttctttcactgggcgttcggtgtcactgagcca
ggctgctatggtgtcatcgatgttgacactgggaagtcgaccctgtttgtgcccaggctt
cctgccagccatgccacctggatgggaaagatccattccaaggagcacttcaaggagaag
tatgccgtggacgacgtccagtacgtagatgagattgccagcgtcctgacgtcacagaag
ccctctgtcctcctcactttgcgtggcgtcaacacggacagcggcagtgtctgcagggag
gcctcctttgacggcatcagcaagttcgaagtcaacaataccattcttcacccagagatc
gttgagtgccgagtgtttaagacggatatggagctggaggttctgcgctataccaataaa
atctccagcgaggcccaccgtgaggtaatgaaggctgtaaaagtgggaatgaaagaatat
gagttggaaagcctcttcgagcactactgctactcccggggcggcatgcgccacagctcc
tacacctgcatctgcggcagtggtgagaactcagccgtgctacactacggacacgccgga
gctcccaacgaccgaacgatccagaatggggatatgtgcctgttcgacatgggcggtgag
tattactgcttcgcttccgacatcacctgctcctttcccgccaacggcaagttcactgca
gaccagaaggccgtctatgaggcagtgctgcggagctcccgtgccgtcatgggtgccatg
aagccaggtgtctggtggcctgacatgcaccgcctggctgaccgcatccacctggaggag
ctggcccacatgggcatcctgagcggcagcgtggacgccatggtccaggctcacctgggg
gccgtgtttatgcctcacgggcttggccacttcctgggcattgacgtgcacgacgtggga
ggctacccagagggcgtggagcgcatcgacgagcccggcctgcggagcctgcgcactgca
cggcacctgcagccaggcatggtgctcaccgtggagccgggcatctacttcatcgaccac
ctcctggatgaggccctggcggacccggcccgcgcctccttccttaaccgcgaggtcctg
cagcgctttcgcggttttggcggggtccgcatcgaggaggacgtcgtggtgactgacagc
ggcatagagctgctgacctgcgtgccccgcactgtggaagagattgaagcatgcatggca
ggctgtgacaaggcctttacccccttctctggccccaagtag

DBGET integrated database retrieval system