KEGG   Homo sapiens (human): 5193Help
Entry
5193              CDS       T01001                                 

Gene name
PEX12, PAF-3, PBD3A
Definition
peroxisomal biogenesis factor 12
Orthology
K13345  
peroxin-12
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00205  
Peroxisome biogenesis disorder
H01342  
Zellweger syndrome (ZS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    5193 (PEX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12
AA seq 359 aa AA seqDB search
MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFD
EIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFL
VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR
YILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAV
GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM
KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcacggggctcacttcacagctgcttctgtggccgatgaccagccatccatc
tttgaggtggtagcacaggacagtttaatgacagcagtgagacccgctcttcagcatgtg
gtcaaggttcttgcagaatcaaatcccacccactatggcttcttgtggaggtggtttgat
gaaatctttactctgctagatcttctgctccagcaacattatctgtctagaaccagtgcc
tcattttctgaaaacttttacggcttaaagagaattgtaatgggggacactcacaagtct
cagagattggctagtgctggtctcccaaagcagcagctttggaaatctattatgttcctg
gttcttcttccctatctgaaagtgaagctggagaagctggtttctagcctgagagaagag
gatgaatattctattcatcccccttcttcccgctggaaacgattttacagagctttcctg
gcagcctacccatttgtgaacatggcctgggaaggatggtttcttgtacaacaacttcga
tacatcctaggaaaagctcagcatcactcaccactgctgaggctggctggagttcagcta
ggtcgactgacagttcaggatatacaagctctggagcacaaaccagctaaggccagcatg
atgcagcaaccagccaggagtgttagtgagaagataaactcagctctgaagaaagctgtt
gggggtgttgccttatccctgtctactggcctttctgtgggtgtattcttcttgcagttc
cttgactggtggtactcatctgaaaatcaagaaaccatcaagtcattgactgccctgcct
actccaccaccacctgtacacctagactataactctgattctcccctcttacccaaaatg
aagactgtgtgcccactgtgtcgtaaaacccgggtgaatgatactgttcttgccacctct
ggctatgtgttttgttaccgctgtgtgtttcattatgtgaggagtcaccaagcttgtccc
atcacaggttatccaacagaagtacaacatctgattaaactctactcccctgagaactga

DBGET integrated database retrieval system