KEGG   Homo sapiens (human): 5261Help
Entry
5261              CDS       T01001                                 

Gene name
PHKG2, GSD9C
Definition
phosphorylase kinase, gamma 2 (testis) (EC:2.7.11.19)
Orthology
K00871  
phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Insulin signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5261 (PHKG2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5261 (PHKG2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     5261 (PHKG2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PHK family
   5261 (PHKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 406 aa AA seqDB search
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggacgtggggccggaggatgagctgcccgactgggccgccgccaaagagttt
taccagaagtacgaccctaaggacgtcatcggcagaggagtgagctctgtggtccgccgt
tgtgttcatcgagctactggccacgagtttgcggtgaagattatggaagtgacagctgag
cggctgagtcctgagcagctggaggaggtgcgggaagccacacggcgagagacacacatc
cttcgccaggtcgccggccacccccacatcatcaccctcatcgattcctacgagtcttct
agcttcatgttcctggtgtttgacctgatgcggaagggagagctgtttgactatctcaca
gagaaggtggccctctctgaaaaggaaaccaggtccatcatgcggtctctgctggaagca
gtgagctttctccatgccaacaacattgtgcatcgagatctgaagcccgagaatattctc
ctagatgacaatatgcagatccgactttcagatttcgggttctcctgccacttggaacct
ggcgagaagcttcgagagttgtgtgggaccccagggtatctagcgccagagatccttaaa
tgctccatggatgaaacccacccaggctatggcaaggaggtcgacctctgggcctgtggg
gtgatcttgttcacactcctggctggctcgccacccttctggcaccggcggcagatcctg
atgttacgcatgatcatggagggccagtaccagttcagttcccccgagtgggatgaccgt
tccagcactgtcaaagacctgatctccaggctgctgcaggtggatcctgaggcacgcctg
acagctgagcaggccctacagcaccccttctttgagcgttgtgaaggcagccaaccctgg
aacctcaccccccgccagcggttccgggtggcagtgtggacagtgctggctgctggacga
gtggccctaagcacccatcgtgtacggccactgaccaagaatgcactgttgagggaccct
tatgcgctgcggtcagtgcggcacctcatcgacaactgtgccttccggctctacgggcac
tgggtaaagaaaggggagcagcagaaccgggcggctctctttcagcaccggccccctggg
ccttttcccatcatgggccctgaagaggagggagactctgctgctataactgaggatgag
gccgtgcttgtgctgggctag

DBGET integrated database retrieval system