KEGG   Homo sapiens (human): 5264Help
Entry
5264              CDS       T01001                                 

Gene name
PHYH, LN1, LNAP1, PAHX, PHYH1, RD
Definition
phytanoyl-CoA 2-hydroxylase (EC:1.14.11.18)
Orthology
K00477  
phytanoyl-CoA hydroxylase [EC:1.14.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00075  
Refsum disease
Class
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p13
AA seq 238 aa AA seqDB search
MRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLIN
KPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPH
DYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISC
HFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtgaccatttcgaaatccgaatatgctccaagtgagaagatgatcacgaag
gtccaggatttccaggaagataaggagctcttcagatactgcactctccccgagattctg
aaatatgtggagtgcttcactggacctaatattatggccatgcacacaatgttgataaac
aaacctccagattctggcaagaagacgtcccgtcaccccctgcaccaggacctgcactat
ttccccttcaggcccagcgatctcatcgtttgcgcctggacggcgatggagcacatcagc
cggaacaacggctgtctggttgtgctcccaggcacacacaagggctccctgaagccccac
gattaccccaagtgggaggggggagttaacaaaatgttccacgggatccaggactacgag
gaaaacaaggcccgggtgcacctggtgatggagaagggcgacactgttttcttccatcct
ttgctcatccacggatctggtcagaataaaacccagggattccggaaggcaatttcctgc
catttcgccagtgccgattgccactacattgacgtgaagggcaccagtcaagaaaacatc
gagaaggaagttgtaggaatagcacataaattctttggagctgaaaatagcgtgaacttg
aaggatatttggatgtttcgagctcgacttgtgaaaggagaaagaaccaatctttga

DBGET integrated database retrieval system